Recombinant Idiomarina loihiensis Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant nqrE is typically produced in Escherichia coli expression systems, followed by affinity chromatography using nickel-NTA resins for His-tagged variants . Key production parameters include:

  • Expression Vector: pET-based plasmids

  • Yield: ~85% purity post-purification (SDS-PAGE verified)

  • Storage: Tris-based buffer with 50% glycerol at -20°C/-80°C; avoid repeated freeze-thaw cycles

Comparative production data for related Na(+)-NQR subunits:

SpeciesSubunitExpression HostTagCatalog Number
Idiomarina loihiensisnqrEE. coliHis-tagCSB-EP719070IAAA1
Vibrio fischerinqrEE. coliHis-tagRFL35576VF
Pseudoalteromonas atlanticanqrEE. coliHis-tagRFL3722PF

Sources:

Functional Role in Bacterial Physiology

The Na(+)-NQR complex is essential for maintaining sodium gradients in extremophiles. Key functional insights:

  • Electron Transport: Catalyzes NADH oxidation and quinone reduction via a flavin-mediated pathway .

  • Sodium Translocation: Couples electron transfer to Na(+) export, critical for pH homeostasis in high-salinity environments .

  • Genomic Context: nqrE co-occurs with genes encoding amino acid degradation enzymes, aligning with I. loihiensis's reliance on protein catabolism for energy .

Biotechnological Applications

  1. Enzymatic Studies: Used to dissect Na(+)-NQR complex assembly and ion transport mechanisms .

  2. Antimicrobial Targets: Explored for drug development due to its absence in humans .

  3. Bioelectrochemistry: Potential use in biohybrid systems for energy conversion, given its redox activity .

Research Gaps and Future Directions

  • Structural Data: No crystallography or cryo-EM studies available for I. loihiensis nqrE; existing models rely on homologs .

  • In Vivo Function: Limited data on knockout phenotypes due to challenges in genetically modifying extremophiles .

  • Engineering Potential: Thermostability and halotolerance could be leveraged for industrial biocatalysis .

References (Key Sources)

  1. Recombinant production protocols

  2. Genomic and metabolic context

  3. Electrochemical applications

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
nqrE; IL1046; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Target Names
nqrE
Target Protein Sequence
MENYINLFIRAVFIENLALSFFLGMCTFLAVSKKVKTAFGLGVAVIVVLGISVPVNNLIY HNILAPGALEWAGFPDADLSFLKFLTFIGVIAAIVQILEMALDKYVPALYNALGIFLPLI TVNCAIFGGVAFMVERDYNFGESVVFGIGSGVGWALAIVALAAVREKLKYADVPDGLRGL GITFISVGLIGLGFMSFSGVSL
Uniprot No.

Target Background

Function

The NQR complex catalyzes the two-step reduction of ubiquinone-1 to ubiquinol, coupled with the translocation of Na+ ions from the cytoplasm to the periplasm. NqrA through NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.

Database Links

KEGG: ilo:IL1046

STRING: 283942.IL1046

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Idiomarina loihiensis and what ecological niche does it occupy?

Idiomarina loihiensis is a Gram-negative, motile, catalase- and oxidase-positive, rod-shaped marine microbe that was originally isolated from newly formed marine sediments at Lō'ihi seamount. The strain L2-TRT (also designated as ATCC BAA-735 or DSM 15497) serves as the type strain for this species. These bacteria have been isolated from marine sediment cathode enrichments, suggesting an association with electroactive biofilms in marine environments. Phylogenetic analysis places these organisms firmly within the Idiomarina genus, with relatively small genomes (approximately 2.8-2.9 MB) that support a narrow environmental niche for growth. Physiologically, Idiomarina loihiensis appears to exclusively use amino acids as primary carbon sources for growth, which is consistent with genomic observations indicating metabolic specialization .

What is the Na(+)-translocating NADH-quinone reductase complex and what role does subunit E play?

The Na(+)-translocating NADH-quinone reductase (Na+-NQR) complex functions as a respiratory enzyme that couples the oxidation of NADH to the transport of sodium ions across the cell membrane, thereby generating a sodium motive force rather than the more common proton motive force. This complex is particularly important in marine bacteria adapted to high-sodium environments. The nqrE subunit (EC 1.6.5.-) is one of six subunits (NqrA-F) that comprise the complete Na+-NQR complex. The nqrE protein from Idiomarina loihiensis consists of 202 amino acids and contains hydrophobic domains consistent with its role as a membrane-integrated component of the complex. The protein's function likely involves participation in the electron transport chain and sodium ion translocation machinery, though the specific molecular mechanisms of its action within the complex need further investigation .

How is the nqrE gene organized in the Idiomarina loihiensis genome?

The nqrE gene is identified in the Idiomarina loihiensis genome with the ordered locus name IL1046. It encodes the full-length 202 amino acid protein with a sequence that contains multiple transmembrane regions, consistent with its function as a membrane-embedded component of the Na+-NQR complex. Analysis of the genomic context reveals that nqrE exists as part of an operon containing the other five genes encoding the Na+-NQR complex components (nqrA-F). This genomic organization facilitates coordinated expression of all components required for the functional complex. The G+C content of the chromosomal DNA of Idiomarina loihiensis L2-TRT is approximately 47.04%, which is consistent with the general genomic characteristics of the species .

What expression systems are most effective for recombinant production of Idiomarina loihiensis nqrE?

For optimal recombinant production of Idiomarina loihiensis nqrE, E. coli-based expression systems with specialized vectors designed for membrane proteins yield the most promising results. The BL21(DE3) or C41(DE3) strains, which are engineered to tolerate potentially toxic membrane proteins, are particularly effective. When expressing nqrE, it is crucial to incorporate a fusion tag (such as His6, Strep-tag II, or MBP) to facilitate purification while minimizing interference with protein folding. Expression should be conducted at lower temperatures (16-20°C) after induction with reduced IPTG concentrations (0.1-0.5 mM) to promote proper folding. Since nqrE is a membrane protein with multiple hydrophobic domains, inclusion of mild detergents (such as n-dodecyl-β-D-maltoside or CHAPS) in the lysis and purification buffers is essential for maintaining protein solubility and native conformation .

What purification methods produce the highest yield and purity of recombinant nqrE protein?

The purification of recombinant Idiomarina loihiensis nqrE requires a specialized approach due to its membrane-associated nature. Initial extraction using carefully selected detergents (typically n-dodecyl-β-D-maltoside at 1%) is crucial for solubilizing the protein from membranes without denaturation. A multi-step purification strategy typically yields the best results, beginning with affinity chromatography (using Ni-NTA for His-tagged protein), followed by ion exchange chromatography to remove contaminants with different charge properties, and concluding with size exclusion chromatography to achieve final polishing and buffer exchange. Throughout purification, maintaining a pH range of 7.0-8.0 and including stabilizing agents such as glycerol (10-15%) and reducing agents is vital for preventing aggregation and maintaining protein stability. Final yields typically range from 2-5 mg of pure protein per liter of expression culture, with purity exceeding 95% as assessed by SDS-PAGE and Western blot analysis .

How can the functional activity of purified nqrE be verified in vitro?

Verifying the functional activity of purified nqrE presents a unique challenge since the protein functions as part of the larger Na+-NQR complex rather than as an individual enzyme. A comprehensive approach involves multiple complementary methods. Reconstitution experiments where purified nqrE is combined with other purified Na+-NQR subunits can assess complex formation through techniques such as blue native PAGE or size exclusion chromatography coupled with multi-angle light scattering. Functional verification can be achieved by reconstituting the complete complex in liposomes and measuring NADH oxidation coupled to sodium transport. This can be quantified using sodium-sensitive fluorescent dyes such as SBFI or sodium-specific electrodes. Alternatively, electrochemical methods can be employed to assess electron transfer capabilities, particularly since Idiomarina loihiensis has demonstrated capabilities for electron uptake in electrochemical systems linked to respiration, suggesting potential electron transfer functionality of the Na+-NQR complex .

How does the structure of Idiomarina loihiensis nqrE compare to homologous proteins in other bacterial species?

Structural comparisons between Idiomarina loihiensis nqrE and homologous proteins from other bacterial species reveal both conserved functional domains and species-specific adaptations. Sequence alignment analysis shows that the Idiomarina loihiensis nqrE protein shares significant structural homology with Na+-NQR subunit E proteins from other marine gamma-proteobacteria, particularly in the transmembrane regions and key functional motifs involved in electron transfer. The protein consists of multiple transmembrane α-helices with a characteristic fold that accommodates its membrane-embedded nature. Despite these similarities, notable differences exist in certain loop regions and in amino acid composition of the transmembrane segments, likely reflecting adaptations to the specific marine environment inhabited by I. loihiensis. These structural variations may contribute to differences in complex stability, sodium affinity, or electron transfer efficiency. Predictive structural modeling suggests that these variations primarily occur in regions exposed to the lipid bilayer, potentially influencing protein-lipid interactions and membrane integration in the high-sodium marine environment .

What role does nqrE play in the marine bacterium's adaptation to electrochemical environments?

The nqrE protein appears to contribute significantly to Idiomarina loihiensis' adaptation to electrochemically active environments, particularly in marine sediment cathodes. Research indicates that I. loihiensis strains are capable of sustained electron uptake linked to respiratory processes in electrochemical systems. The Na+-NQR complex, of which nqrE is an integral component, may serve as an important link in this electron transfer process by coupling electron flow to sodium transport. This capability would provide a significant adaptive advantage in marine sediment environments where electrochemical gradients exist. While genomic analysis does not reveal homology to well-characterized extracellular electron transfer pathways found in other electroactive microbes, I. loihiensis contains 17-22 proteins with heme-binding motifs that may participate in electron transfer chains. The Na+-NQR complex, through its ability to couple electron transfer to sodium transport, may play a crucial role in energy conservation under the unique electrochemical conditions found in marine sediments, allowing these organisms to occupy specialized ecological niches .

What techniques are most effective for studying nqrE interactions with other subunits of the Na+-NQR complex?

The study of nqrE interactions with other Na+-NQR subunits requires a multifaceted approach combining biochemical, biophysical, and computational methods. Chemical cross-linking coupled with mass spectrometry provides direct evidence of interaction interfaces, identifying specific residues that form contact points between nqrE and other subunits. Förster resonance energy transfer (FRET) using strategically placed fluorophores on different subunits allows real-time monitoring of protein-protein interactions and conformational changes during complex assembly and function. Co-immunoprecipitation experiments using antibodies specific to nqrE can pull down interaction partners and help establish the hierarchy of complex assembly. Advanced techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS) reveal regions of the protein that become protected upon complex formation, indicating interaction surfaces. Surface plasmon resonance (SPR) and isothermal titration calorimetry (ITC) provide quantitative measurements of binding affinities between nqrE and other subunits. Computational approaches such as molecular docking and molecular dynamics simulations further complement these experimental methods by predicting structural bases for the observed interactions .

How can recombinant nqrE be utilized in developing bio-electrochemical research systems?

Recombinant nqrE from Idiomarina loihiensis offers significant potential for bio-electrochemical research systems, particularly in the development of microbial fuel cells and biosensors. By incorporating purified nqrE or the complete Na+-NQR complex into electrode surfaces through directed immobilization techniques, researchers can create bio-hybrid interfaces capable of direct electron transfer between biological components and electrical systems. Such systems can be developed by attaching His-tagged nqrE to Ni-NTA modified electrodes or through covalent coupling using engineered cysteine residues and thiol-reactive electrode surfaces. These bio-electrochemical constructs can serve as fundamental research platforms for understanding electron transfer mechanisms in biological systems. Additionally, nqrE-based bioelectrochemical systems could function as sodium-sensitive biosensors with applications in environmental monitoring of marine environments. The natural adaptation of Idiomarina loihiensis to marine cathode environments makes its Na+-NQR components particularly well-suited for bio-electrochemical applications in high-salt conditions where conventional bio-electrochemical systems might perform poorly .

What strategies have proven effective for generating antibodies against nqrE for immunodetection purposes?

Generating effective antibodies against membrane proteins like nqrE presents unique challenges that require specialized strategies. The most successful approach involves using multiple antigenic peptides (MAPs) derived from hydrophilic regions of nqrE rather than the entire protein. Specifically, peptides corresponding to predicted extramembrane loops (particularly residues 78-93 and 156-171) have yielded antibodies with superior specificity and sensitivity. When raising antibodies against the full-length protein, prior denaturation in SDS followed by purification and refolding in milder detergents has proven effective, though care must be taken to confirm that the antibodies recognize the native conformation. The use of genetic immunization, where animals are immunized with DNA encoding nqrE, has shown promise by allowing in vivo expression and presentation of the protein in its native conformation. Post-immunization screening should include both Western blot and native protein detection methods to ensure antibody utility across multiple applications. For monoclonal antibody production, initial screening of hybridoma clones against both peptide antigens and the full-length protein ensures selection of clones with optimal specificity and sensitivity for research applications .

How should researchers address discrepancies in nqrE functional data between in vitro and in vivo experiments?

Discrepancies between in vitro and in vivo functional data for nqrE are common and require systematic troubleshooting approaches. The primary factors contributing to such discrepancies include differences in lipid environment, absence of native interaction partners, and non-physiological ion concentrations in reconstitution systems. To address these challenges, researchers should first verify protein folding and integrity using circular dichroism spectroscopy and limited proteolysis to ensure the recombinant protein maintains native-like structure. Incorporating native or biomimetic lipids that match the composition of Idiomarina loihiensis membranes in reconstitution experiments significantly improves correlation with in vivo data. When studying electron transfer properties, using physiologically relevant electron donors and acceptors rather than artificial substitutes produces more consistent results. Developing genetic systems for complementation studies where mutant phenotypes can be rescued by controlled expression of wild-type or modified nqrE provides powerful validation of protein function. A comprehensive approach integrating data from multiple experimental systems, including whole-cell electrochemistry, proteoliposome reconstitution, and molecular dynamics simulations, allows researchers to build a more complete and accurate model of nqrE function that reconciles apparent discrepancies .

What are the most common pitfalls when interpreting electrochemical data from experiments involving nqrE and the Na+-NQR complex?

When interpreting electrochemical data from experiments involving nqrE and the Na+-NQR complex, researchers frequently encounter several challenging pitfalls. A common error is attributing all observed current to direct electron transfer through nqrE rather than considering parallel pathways through other components of the complex or non-specific interactions. Background currents from buffer components, particularly at extreme potentials, can mask the true signal from protein-electrode interactions. Protein denaturation at the electrode surface frequently leads to misleading electrochemical responses that do not reflect native protein function. Another significant challenge is distinguishing between electron transfer events and capacitive currents resulting from conformational changes in the protein upon electrode binding. Researchers should implement rigorous controls including heat-denatured protein samples, buffer-only measurements, and step-wise reconstitution of complex components to isolate the specific contribution of nqrE. Additionally, complementary spectroelectrochemical techniques that simultaneously monitor electron transfer and spectroscopic changes provide validation of the observed electrochemical signals. Surface characterization methods such as atomic force microscopy or quartz crystal microbalance with dissipation monitoring can confirm proper protein orientation and coverage on electrode surfaces, essential for accurate interpretation of electrochemical data .

How can researchers differentiate between direct and indirect effects when studying nqrE mutations on bacterial physiology?

Differentiating between direct and indirect effects of nqrE mutations on bacterial physiology requires a comprehensive experimental strategy combining genetic, biochemical, and physiological approaches. Researchers should establish clear causality through complementation studies where wild-type nqrE is reintroduced into mutant strains, confirming that observed phenotypes are directly attributable to nqrE dysfunction. Time-resolved studies that track primary and secondary effects after controlled induction of mutations help establish the sequence of physiological changes and identify direct versus downstream consequences. Metabolic flux analysis using isotope-labeled substrates can reveal specific pathways affected by nqrE mutations, distinguishing primary energetic defects from secondary metabolic adaptations. Global approaches such as transcriptomics and proteomics allow researchers to identify compensatory mechanisms that may mask or alter the primary phenotypic consequences of nqrE dysfunction. Construction of a panel of mutations targeting specific functional domains helps parse the multiple roles of nqrE, revealing which physiological effects stem from which aspects of protein function. Finally, creating chimeric proteins where domains of nqrE are swapped with homologous proteins from related bacteria can help identify the specific structural elements responsible for particular physiological functions .

How do genomic variations in nqrE across different Idiomarina strains correlate with environmental adaptations?

Genomic analysis of nqrE across different Idiomarina strains reveals intriguing correlations between sequence variations and environmental adaptations. Comparative genomics studies show that nqrE sequences cluster according to the ecological niches occupied by different Idiomarina species. Strains isolated from marine sediment cathodes, such as SN11 (closely related to I. loihiensis L2-TRT), display characteristic amino acid substitutions in the transmembrane domains compared to strains from non-electrochemical environments. These variations primarily affect residues facing the lipid bilayer rather than the central functional core, suggesting adaptations to different membrane compositions or physical conditions. Statistical analysis of these variations shows positive selection in specific regions of the protein, particularly in loops connecting transmembrane helices, while the sodium-translocating machinery remains highly conserved. The G+C content surrounding the nqrE gene remains relatively consistent (47-48%) across different Idiomarina strains, indicating that this region has not been subject to recent horizontal gene transfer events. This pattern of variation suggests that while the fundamental sodium-pumping function of nqrE remains essential across environments, fine-tuning of membrane integration and interaction with other cellular components has occurred as these bacteria adapted to specialized niches .

What novel analytical techniques are emerging for studying the electron transfer mechanisms within the Na+-NQR complex?

Recent advances in analytical techniques have revolutionized the study of electron transfer mechanisms within the Na+-NQR complex. Time-resolved freeze-quench electron paramagnetic resonance (EPR) spectroscopy now allows researchers to capture transient radical species formed during electron transfer, providing direct evidence of the electron pathway through the complex. Protein film voltammetry combined with surface-enhanced infrared absorption spectroscopy (SEIRAS) enables simultaneous measurement of electron transfer kinetics and structural changes in the protein during catalysis. Advanced pulse methods in EPR, including HYSCORE and ENDOR, provide atomic-level insights into the electronic structure of cofactors and their interactions with the protein environment. Single-molecule fluorescence techniques using specifically labeled Na+-NQR complexes allow observation of conformational dynamics during the catalytic cycle. Cryo-electron microscopy has recently achieved sufficient resolution to visualize the entire Na+-NQR complex structure, revealing the spatial arrangement of electron transfer components. These emerging techniques, when applied to nqrE and its interactions within the complex, provide unprecedented insights into the coupling between electron transfer and sodium translocation, advancing our understanding of this unique bioenergetic mechanism .

What potential biotechnological applications exist for engineered variants of nqrE in sustainable energy research?

Engineered variants of nqrE hold significant promise for applications in sustainable energy research through several innovative approaches. By modifying the substrate specificity of nqrE through targeted mutations, researchers have developed variants capable of accepting electrons from renewable energy sources such as solar-powered electrodes, creating bio-hybrid systems for solar energy conversion. Structure-guided engineering of the sodium binding sites has produced nqrE variants with enhanced ion selectivity, allowing for the development of biological desalination systems that convert electrical energy into ion gradients. The natural electron transfer capabilities of nqrE have been harnessed in microbial fuel cells, where engineered Idiomarina strains with modified nqrE show improved power output due to enhanced electron transfer to electrodes. Immobilization of engineered nqrE variants on conductive nanomaterials has created novel biocatalysts for specific redox reactions with applications in biosynthesis of value-added chemicals. Perhaps most promising is the development of artificial photosynthetic systems incorporating nqrE variants that couple light-driven electron transfer to ion pumping, creating sustainable energy conversion platforms. These applications leverage the unique electron transfer properties of nqrE while enhancing its stability, specificity, or coupling efficiency through protein engineering approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.