Recombinant Idiomarina loihiensis Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Primary Structure and Sequence

HtpX from Idiomarina loihiensis is a full-length protein of 287–293 amino acids (aa), depending on truncation or expression system. Key features include:

  • N-terminal His-tag for purification (6xHis or similar) .

  • Zinc-binding motif: Conserved residues (e.g., H136EXXH) indicative of metalloprotease activity .

  • Membrane localization: Predicted membrane-anchoring domains, though recombinant forms are soluble .

PropertyValue/DescriptionSource
Molecular Weight~31,436 Da
Sequence Length287–293 aa
Purification Purity>85–90% (SDS-PAGE)
Storage BufferTris/PBS-based, 6% trehalose, pH 8.0
Stability-20°C/-80°C; avoid freeze-thaw cycles

Amino Acid Sequence (Partial):
MKRVLLFLATNMAILLVVSVVFNIVMAVTGIDAQGSVGLLVFCALFGFGGAFVSLWISRW...
(Full sequence available in )

Expression and Refolding

Recombinant HtpX is expressed in E. coli under optimized conditions, followed by:

  1. Denaturing purification: Solubilization and chromatography under reducing conditions.

  2. Refolding: In vitro refolding in zinc-supplemented buffers to restore activity .

ParameterDetailSource
Expression SystemE. coli (His-tagged)
Purity MethodSDS-PAGE, HPLC
Activity RestorationZn²⁺ supplementation post-refolding

Catalytic Activity

HtpX exhibits zinc-dependent endopeptidase activity, cleaving both soluble and membrane-associated substrates. Key findings include:

  • Substrate Specificity: Targets misfolded membrane proteins (e.g., SecY in E. coli) .

  • Self-degradation: Undergoes autolysis under stress conditions (e.g., membrane disruption) .

FeatureDescriptionAnalogue (E. coli HtpX)Source
Proton Motive ForceZn²⁺-dependentZn²⁺-dependent
Substrate CleavageMembrane proteins (e.g., SecY)Membrane proteins
Quality Control RoleDegradation of misfolded proteinsFtsH collaboration

Halophilic Adaptation and Enzyme Production

Studies on Idiomarina loihiensis proteases highlight:

  • Optimal Activity: Enhanced proteolytic activity at 10% NaCl and pH 8.0 .

  • Industrial Potential: Salt-tolerant enzymes for bioremediation or food processing .

ConditionActivity LevelSource
Salt Concentration10% NaCl (maximal)
pH Range8.0 (optimal)
Temperature StabilityMesophilic (room temp)

Comparative Analysis

FeatureIdiomarina loihiensis HtpXE. coli HtpX
LocalizationRecombinant (soluble)Membrane-bound
Substrate PreferenceSoluble/membrane proteinsMembrane proteins
Chaperone InteractionNot reportedFtsH collaboration

Potential Uses

  1. Protein Quality Control: Degradation of misfolded proteins in bioproduction systems .

  2. Bioremediation: Salt-tolerant proteases for waste treatment in saline environments .

  3. Research Tool: Study of membrane protein folding and proteolytic pathways .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
htpX; IL1320; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Target Names
htpX
Target Protein Sequence
MKRVLLFLATNMAILLVVSVVFNIVMAVTGIDAQGSVGLLVFCALFGFGGAFVSLWISRW MAIRSTGARVIEKPQNQSEEWLFRTVQQQAQKAGVPMPQVAVYQSPEPNAFATGRSKNAS LVAVSTGLLQSMNADEVEAVLAHEMSHIANGDMVTLTLIQGVINTFVMFFARIIASAIMR GGDNQRGGGFAYYGVVMLLEIVFGVLASTIVMWFSRQREFRADAGSADLVGKQKMIAALR RLQQGKESELDGTMLAFGIKGKRSTMSKLFMSHPPLEERIHALEQRR
Uniprot No.

Target Background

Database Links

KEGG: ilo:IL1320

STRING: 283942.IL1320

Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Idiomarina loihiensis Protease HtpX and what is its biological significance?

Protease HtpX from Idiomarina loihiensis is an M48 family zinc metalloproteinase encoded by the htpX gene. This membrane-integrated protein is believed to play a crucial role in the quality control of membrane proteins by eliminating malfolded or misassembled proteins that could otherwise compromise membrane integrity and function .

Idiomarina loihiensis itself is a deep-sea γ-proteobacterium isolated from hydrothermal vents at 1,300-meter depth on the Lōihi submarine volcano in Hawaii. This bacterium has adapted to survive in extreme conditions, including a wide range of temperatures (4°C to 46°C) and salinities (0.5% to 20% NaCl) . The protease is part of the bacterial stress response system that helps maintain cellular homeostasis under challenging environmental conditions.

How can researchers establish a reliable assay system to measure HtpX protease activity?

Researchers working with HtpX proteases can adopt a methodology similar to that developed for E. coli HtpX, which involves:

  • Construction of model substrates specifically designed for HtpX proteolysis detection

  • Implementation of an in vivo semiquantitative protease activity assay system

One effective approach involves creating a fusion protein substrate that, when cleaved by HtpX, produces fragments detectable by immunoblotting or fluorescence methods. For example, researchers have developed an assay system using a model substrate (referred to as XMS1) that allows for sensitive detection of differential protease activities among HtpX variants .

For optimal results, the assay should:

  • Incorporate appropriate controls for background proteolysis

  • Include known HtpX inhibitors as negative controls

  • Use wild-type and catalytically inactive mutants for comparison

  • Employ quantification methods (e.g., densitometry of immunoblots) to provide semi-quantitative measurements of proteolytic activity

What expression systems are most effective for producing recombinant Idiomarina loihiensis Protease HtpX?

Cell-free expression systems have proven effective for producing recombinant Idiomarina loihiensis Protease HtpX with high purity (≥85% as determined by SDS-PAGE) . This approach is particularly valuable for membrane proteins like HtpX that might be toxic or form inclusion bodies in conventional cell-based expression systems.

For researchers seeking to express this protein:

  • Cell-free expression systems allow better control over the reaction environment and can be optimized for membrane protein production

  • Addition of appropriate detergents or lipid nanodiscs can help maintain proper folding of the transmembrane domains

  • Inclusion of zinc ions in the expression buffer may be crucial for ensuring proper metalloprotease activity

  • Purification typically involves affinity chromatography using tags such as His-tags, which can be incorporated at either terminus depending on experimental requirements

How does Idiomarina loihiensis Protease HtpX contribute to bacterial adaptation in extreme environments?

Idiomarina loihiensis inhabits deep-sea hydrothermal vents characterized by fluctuating conditions, including temperature variations, high pressure, and elevated concentrations of heavy metals. The protease HtpX appears to play a critical role in this adaptation through several mechanisms:

  • Membrane protein quality control: By removing damaged or misfolded membrane proteins, HtpX helps maintain membrane integrity under stress conditions .

  • Stress response participation: As part of the heat shock protein family, HtpX contributes to the cellular response to various stressors including temperature fluctuations and oxidative damage.

  • Integration with metabolic adaptation: I. loihiensis relies primarily on amino acid catabolism rather than sugar fermentation for carbon and energy, according to genomic analysis . The abundance of proteases, including HtpX, may facilitate the acquisition and utilization of proteinaceous nutrients in this environment.

The bacteria likely colonize proteinaceous particles in the hydrothermal vent waters using secreted exopolysaccharides, and then utilize proteases like HtpX as part of their nutrient acquisition and stress management systems .

What is known about the substrate specificity of HtpX proteases and how can researchers identify potential physiological substrates?

The substrate specificity of HtpX proteases remains incompletely characterized, largely due to challenges in identifying physiological substrates. Based on studies with E. coli HtpX:

  • HtpX appears to target membrane proteins with specific structural features, particularly those that are misfolded or damaged.

  • The protease likely recognizes specific sequence motifs or structural elements within transmembrane domains.

Researchers seeking to identify physiological substrates of Idiomarina loihiensis HtpX might employ the following strategies:

  • Comparative proteomics: Analysis of the membrane proteome in wild-type versus htpX knockout strains under various stress conditions

  • Substrate trapping: Using catalytically inactive mutants (e.g., mutations in the zinc-binding site) to trap enzyme-substrate complexes

  • Synthetic peptide libraries: Screening libraries to identify sequence preferences at the cleavage site

  • Bioinformatic prediction: Computational approaches to identify potential substrates based on structural features common to known HtpX substrates

How conserved is HtpX across bacterial species and what does this suggest about its fundamental importance?

HtpX shows remarkable conservation across diverse bacterial species, indicating its fundamental importance in bacterial physiology. Analysis of Neisseria gonorrhoeae revealed that HtpX is completely conserved across both drug-resistant and drug-susceptible isolates . This high degree of conservation makes HtpX a potential target for broad-spectrum antimicrobial development.

Key observations regarding HtpX conservation include:

  • The zinc-binding residues essential for catalytic activity are highly conserved

  • Transmembrane topology appears to be preserved across species

  • Critical functional domains show strong sequence similarity even in distantly related bacteria

This conservation suggests that HtpX performs an essential function that cannot be readily compensated by other proteases, making it a potential vulnerability in bacterial systems that could be exploited for therapeutic purposes.

What structural and functional differences exist between HtpX proteases from different bacterial species?

While the core catalytic mechanism is conserved, HtpX proteases from different bacterial species exhibit variations that likely reflect adaptation to different ecological niches:

  • Transmembrane topology: While most HtpX proteins contain four hydrophobic regions that could function as transmembrane segments, there is some variation in the C-terminal region. In E. coli, whether the two C-terminal hydrophobic regions are actually embedded in the membrane remains controversial .

  • Substrate preference: Different bacterial species likely have evolved substrate preferences aligned with their specific metabolic and environmental challenges.

  • Regulatory mechanisms: The expression and regulation of HtpX may vary between species, with some utilizing it primarily as a stress response protein and others incorporating it into normal physiological processes.

Comparative analysis of HtpX from species inhabiting different environments, such as the deep-sea bacterium Idiomarina loihiensis versus the pathogen Neisseria gonorrhoeae, could reveal adaptive modifications that tailor the enzyme to specific ecological challenges.

What role might HtpX play in bacterial antimicrobial resistance, and how can this be experimentally assessed?

Given the complete conservation of HtpX in both drug-resistant and drug-susceptible isolates of Neisseria gonorrhoeae , this protease may play an indirect role in antimicrobial resistance through several potential mechanisms:

To experimentally assess these possibilities, researchers could:

  • Generate conditional knockout mutants of htpX in various bacterial species and evaluate changes in minimum inhibitory concentrations for different antibiotics

  • Perform transcriptomic and proteomic analyses to identify changes in expression of resistance-related genes in htpX mutants

  • Use the identified HtpX inhibitors (pemirolast and thalidomide) as adjuncts to conventional antibiotics to test for synergistic effects

How can researchers exploit HtpX as a potential drug target for antimicrobial development?

Recent research has identified HtpX as a promising antimicrobial target, particularly in pathogens like Neisseria gonorrhoeae . Several approaches can be employed to develop HtpX-targeted antimicrobials:

  • Structure-based drug design: Using structural information about the zinc-binding domain and active site to design specific inhibitors. The critical zinc-binding residue in N. gonorrhoeae HtpX has been mapped to E141, providing a starting point for inhibitor design.

  • High-throughput screening: Composite high-throughput screening followed by molecular dynamics simulations has already identified pemirolast and thalidomide as high-energy binding ligands of N. gonorrhoeae HtpX, with binding constants of Kd = 3.47 μM and Kd = 1.04 μM, respectively .

  • Fragment-based drug discovery: Testing small molecular fragments for binding to HtpX and then expanding these into more potent, selective inhibitors.

  • In vitro and in vivo validation: Promising compounds should be tested for both enzyme inhibition and antimicrobial activity. Both pemirolast and thalidomide have shown dose-dependent reduction in N. gonorrhoeae viability .

CompoundBinding Affinity to NgHtpXdEffect on Bacterial Viability
PemirolastKd = 3.47 μMDose-dependent reduction
ThalidomideKd = 1.04 μMDose-dependent reduction

Given the conservation of HtpX across bacterial species, inhibitors developed for one species might have broad-spectrum activity, though species-specific optimizations may be required for maximum efficacy.

What are the major technical challenges in working with recombinant Idiomarina loihiensis Protease HtpX and how can they be overcome?

Researchers working with recombinant Idiomarina loihiensis Protease HtpX face several technical challenges:

  • Protein solubility and stability: As a membrane protein with multiple transmembrane domains, HtpX can be difficult to maintain in a properly folded, active state outside its native membrane environment.

    • Solution: Utilize detergent screening to identify optimal solubilization conditions; consider nanodiscs or liposome reconstitution for functional studies

  • Maintaining proteolytic activity: Ensuring that the recombinant protein retains its native catalytic activity.

    • Solution: Include appropriate concentrations of zinc ions in buffers; avoid chelating agents; optimize pH and salt concentrations based on the extreme environment of the source organism

  • Substrate identification and assay development: The lack of known physiological substrates complicates functional assays.

    • Solution: Develop artificial substrates with detectable reporters as demonstrated for E. coli HtpX ; employ proteomic approaches to identify potential natural substrates

  • Expression of a potentially toxic protein: Overexpression of active proteases can be toxic to host cells.

    • Solution: Use tightly regulated expression systems; consider cell-free expression systems which have been successful for this protein ; utilize inactive mutants for structural studies

How can researchers effectively study the membrane topology and structure-function relationships of HtpX proteases?

Understanding the membrane topology and structure-function relationships of HtpX proteases requires specialized approaches:

  • Membrane topology mapping:

    • Cysteine accessibility methods: Introducing cysteine residues at various positions and testing their accessibility to membrane-impermeable reagents

    • Fluorescence protease protection assays: Using GFP-tagged constructs to determine orientation relative to the membrane

    • Computational prediction combined with experimental validation: Using algorithms designed for membrane protein topology prediction, followed by targeted experiments to confirm key features

  • Structure-function analysis:

    • Site-directed mutagenesis of conserved residues, particularly the zinc-binding motifs and potential substrate-binding regions

    • Domain swap experiments between HtpX homologs from different species to identify species-specific functional regions

    • In vivo protease activity assays using model substrates to assess the impact of mutations

  • Structural studies:

    • Cryo-electron microscopy for membrane proteins reconstituted in nanodiscs

    • X-ray crystallography of soluble domains or detergent-solubilized protein

    • NMR studies of specific domains or peptide fragments

These methodologies can help elucidate the structural basis for HtpX function and provide insights for rational drug design targeting this protease family.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.