Recombinant Idiomarina loihiensis Protein CrcB homolog (crcB)

What is Idiomarina loihiensis and what ecological niche does it occupy?

Idiomarina loihiensis is a halophilic gamma-Proteobacterium first isolated from hydrothermal vents on the Lō'ihi Seamount, Hawai'i. This bacterium represents a distinct lineage among gamma-Proteobacteria, positioned phylogenetically after the Pseudomonas lineage but before the Vibrio cluster. The organism was initially designated as strain L2-TR(T) during isolation and shares 99.9% 16S rRNA gene sequence similarity with an uncultured eubacterium from sediment at a depth of 11,000 meters in the Mariana Trench .

Idiomarina loihiensis exhibits remarkable adaptability to extreme conditions, surviving in a wide range of temperatures (from 4°C to 46°C) and salinities (from 0.5% to 20% NaCl). This adaptability allows it to inhabit the partially oxygenated cold waters at the periphery of hydrothermal vents . The bacterium has evolved specialized metabolic pathways that enable it to thrive in this constantly changing deep-sea hydrothermal ecosystem.

What is the CrcB homolog protein and what is its putative function?

The CrcB homolog protein in Idiomarina loihiensis is encoded by the crcB gene (ordered locus name: IL0664) and is classified as a membrane protein . Based on homology to other bacterial CrcB proteins, it likely functions as a fluoride ion channel or transporter that helps protect the cell from fluoride toxicity by exporting fluoride ions.

The protein consists of 129 amino acids with the following sequence:
MNNLLLHFFCVAVGGAIGASARFAMVLAMQSFGVRAFPFATLTVNIIGSFFLGLLLAYAEQQPVSETTRLFLGVGLLGAFTTFSTFSVEVVALASQGELLKAALHIAFNVIICIAAVFAAMMLYSTTK

Analysis of this sequence suggests multiple transmembrane domains characteristic of ion channel proteins. Within the context of Idiomarina loihiensis' extreme environment, this protein likely plays a crucial role in maintaining ion homeostasis under varying environmental conditions.

What are the genomic characteristics of Idiomarina loihiensis?

Idiomarina loihiensis possesses a single circular chromosome of 2,839,318 base pairs with an average G+C content of 47% . The genome encodes:

Comparative genomic analysis reveals that most predicted proteins in I. loihiensis have closest homologs in gamma-proteobacteria (77%) or representatives of other proteobacterial subphyla (9%) . Biological roles were assigned to 63% of ORFs, while 11.5% received only general functional predictions, and the remainder remained functionally uncharacterized. Notably, only 4.4% of ORFs had no detectable homologs in public protein databases at the time of analysis .

How should recombinant CrcB homolog protein be stored for optimal stability?

For optimal stability of recombinant Idiomarina loihiensis Protein CrcB homolog, the following storage conditions are recommended:

• Short-term storage (up to one week): Store working aliquots at 4°C .

• General storage: Maintain at -20°C in a Tris-based buffer with 50% glycerol (optimized for this specific protein) .

• Extended storage: Conserve at -20°C or -80°C .

It is important to note that repeated freezing and thawing is not recommended as it can lead to protein degradation and loss of functional activity . Therefore, preparing multiple single-use aliquots during initial processing is advisable for longitudinal experiments.

What experimental approaches are most effective for studying CrcB homolog membrane topology?

When investigating the membrane topology of the CrcB homolog protein from Idiomarina loihiensis, researchers should consider implementing a multi-method approach:

• Computational prediction: Begin with in silico analysis using topology prediction algorithms such as TMHMM, MEMSAT, and TOPCONS to generate initial models of transmembrane segments.

• Cysteine scanning mutagenesis: Systematically replace amino acids with cysteine residues and use membrane-impermeable sulfhydryl reagents to identify exposed regions. This is particularly valuable given the 129-amino acid sequence (MNNLLLHFFCVAVGGAIGASARFAMVLAMQSFGVRAFPFATLTVNIIGSFFLGLLLAYAEQQPVSETTRLFLGVGLLGAFTTFSTFSVEVVALASQGELLKAALHIAFNVIICIAAVFAAMMLYSTTK) of the protein .

• Protein fusion approaches: Create fusion constructs with reporter proteins such as GFP or alkaline phosphatase at various truncation points to determine orientation relative to the membrane.

• Epitope insertion analysis: Introduce epitope tags at predicted loop regions and assess their accessibility through immunolabeling experiments.

• Cryo-EM structural determination: For high-resolution structural information, purify the protein in appropriate detergents or nanodiscs for cryo-electron microscopy analysis.

When conducting these experiments, it's crucial to consider the halophilic origin of Idiomarina loihiensis, which may necessitate adjustments to buffer compositions to maintain native protein conformation during purification and analysis.

How can researchers effectively express recombinant CrcB homolog in heterologous systems?

Successful expression of recombinant Idiomarina loihiensis CrcB homolog in heterologous systems requires careful consideration of several factors:

• Expression system selection: Consider E. coli BL21(DE3) or C43(DE3) strains, which are optimized for membrane protein expression. For challenging cases, Pichia pastoris may provide a eukaryotic alternative with proper membrane insertion machinery.

• Codon optimization: The genome G+C content of Idiomarina loihiensis is 47% , which may require codon optimization when expressing in standard laboratory strains to improve translation efficiency.

• Expression vector design: Incorporate a cleavable affinity tag (His, Strep, or FLAG) for purification. The tag type should be determined during the production process based on protein stability and functionality .

• Induction protocol optimization: Using the full-length protein expression region (1-129) , test various induction temperatures (16-30°C), inducer concentrations, and induction times to maximize functional protein yield.

• Membrane extraction strategy: Develop a solubilization protocol using detergents such as DDM, LMNG, or SMA copolymers that maintain protein stability and function.

• Functional validation: Implement fluoride transport assays using liposome reconstitution experiments or whole-cell assays to confirm proper folding and activity of the expressed protein.

Remember that Idiomarina loihiensis thrives in high salinity environments (up to 20% NaCl) , so including appropriate salt concentrations in buffer systems may be critical for obtaining functional protein.

What methodological approaches can resolve contradictory data about CrcB function?

When faced with contradictory data regarding CrcB homolog function, researchers should implement a systematic troubleshooting approach:

• Cross-validation with multiple techniques: Employ complementary methodologies such as:

  • Electrophysiology (patch-clamp)

  • Fluoride-sensitive electrode measurements

  • Radioisotope flux assays

  • Fluorescent reporter systems

  • Crystallography or cryo-EM structural studies

• Genetic complementation studies: Test the ability of Idiomarina loihiensis crcB to rescue growth phenotypes in crcB deletion strains from model organisms under fluoride stress conditions.

• Site-directed mutagenesis: Create targeted mutations in conserved residues to identify critical functional amino acids within the 129-amino acid sequence .

• Environmental condition matrix: Given that Idiomarina loihiensis inhabits extreme environments, test protein function across a range of conditions:

  Parameter	Range to Test
  Temperature	4°C - 46°C
  Salinity	0.5% - 20% NaCl
  pH	5.0 - 9.0
  Pressure	1 - 130 atm

• In vivo vs. in vitro reconciliation: Compare results from in vitro reconstituted systems with in vivo functional assays to identify potential factors missing in simplified experimental systems.

• Heterologous expression comparisons: Express the protein in different host systems to identify potential host-specific artifacts that may contribute to contradictory results.

How does the metabolic context of Idiomarina loihiensis influence studies of its CrcB homolog?

Understanding the metabolic context of Idiomarina loihiensis is crucial for accurately interpreting CrcB homolog function:

• Amino acid-dependent metabolism: Idiomarina loihiensis relies primarily on amino acid catabolism rather than sugar fermentation for carbon and energy, as evidenced by the abundance of amino acid transport and degradation enzymes, alongside a loss of sugar transport systems and certain enzymes of sugar metabolism .

• Auxotrophic considerations: The organism is auxotrophic for valine and threonine, which was experimentally confirmed through growth studies . When designing growth media for functional studies, these amino acids must be supplied.

• Peptidase abundance: The genome encodes a diverse set of predicted peptidases, including four Xaa-Pro aminopeptidases, seven aminopeptidases of the S9C family, and ten peptidases of the M38 family . This suggests adaptation to a protein-rich environment.

• Ion homeostasis requirements: The CrcB homolog likely participates in a broader ion homeostasis network adapted to fluctuating conditions in hydrothermal vent environments. Studies should consider potential interactions with other ion transport systems.

• Exopolysaccharide production: The genome contains a cluster of 32 genes encoding enzymes for exopolysaccharide and capsular polysaccharide synthesis , which may interact with membrane proteins like CrcB and affect their localization or function.

When conducting heterologous expression or functional reconstitution experiments, researchers should consider how these metabolic adaptations might influence CrcB homolog behavior and potentially include key metabolic components in experimental designs.

What comparative genomic approaches can identify functional conservation among CrcB homologs?

To investigate functional conservation among CrcB homologs across species, researchers should implement the following comparative genomic approaches:

• Phylogenetic profiling: Construct comprehensive phylogenetic trees of CrcB homologs across bacterial lineages, with special attention to extremophiles. Map the presence/absence patterns against environmental niches to identify potential adaptive roles.

• Sequence conservation analysis: Perform multiple sequence alignments of CrcB homologs, including the 129-amino acid sequence from Idiomarina loihiensis , to identify:

  • Universally conserved residues (potential active site residues)

  • Clade-specific conservation patterns (adaptation to specific environments)

  • Variable regions (potential regulatory domains)

• Synteny analysis: Examine gene neighborhoods around crcB loci across species to identify consistently co-occurring genes that might function in the same pathway.

• Domain architecture analysis: Identify any fusions with other domains or variations in protein length that might indicate functional adaptations.

• Selection pressure analysis: Calculate dN/dS ratios across the protein sequence to identify regions under purifying or positive selection, which may indicate functional constraints or adaptations.

• Structural modeling and comparison: Generate structural models of CrcB homologs and compare predicted structures to identify conserved structural features despite sequence divergence.

When performing these analyses, researchers should include the closest known relative, Idiomarina abyssalis KMM 227(T), which shares 98.9% 16S rRNA sequence similarity with Idiomarina loihiensis , to identify species-specific adaptations.

How can researchers design effective mutation studies to identify key functional residues?

When designing mutation studies to identify functional residues in the CrcB homolog, researchers should implement a systematic approach:

• Targeted mutation strategy:

  • Focus on highly conserved residues identified through multiple sequence alignments

  • Target predicted transmembrane domains, particularly those containing charged residues

  • Examine the full 129-amino acid sequence (MNNLLLHFFCVAVGGAIGASARFAMVLAMQSFGVRAFPFATLTVNIIGSFFLGLLLAYAEQQPVSETTRLFLGVGLLGAFTTFSTFSVEVVALASQGELLKAALHIAFNVIICIAAVFAAMMLYSTTK) for patterns suggesting functional domains

• Mutation types to consider:

  • Conservative substitutions (maintaining physicochemical properties)

  • Non-conservative substitutions (altering charge, size, or hydrophobicity)

  • Alanine-scanning mutagenesis (systematically replacing residues with alanine)

  • Cysteine substitutions for subsequent chemical modification studies

• Functional assays:

  • Transport activity assays using reconstituted liposomes

  • Growth complementation in crcB deletion strains under fluoride stress

  • Binding assays with potential substrates or inhibitors

  • Stability and folding assessments using thermal shift assays

• Structure-guided approach:

  • If structural data is unavailable, use computational models to guide mutation design

  • Consider evolutionary coupling analysis to identify co-evolving residues that may interact functionally

• Experimental controls:

  • Include synonymous mutations as negative controls

  • Test mutations in multiple expression systems to rule out host-specific effects

  • Create reversion mutations to confirm specificity of observed phenotypes

When interpreting results, researchers should consider the halophilic adaptation of Idiomarina loihiensis and how this might influence protein-ion interactions and membrane insertion properties.

What are the key considerations for designing immunological studies targeting CrcB homolog?

When developing immunological tools for studying the Idiomarina loihiensis CrcB homolog, researchers should consider:

• Epitope selection strategy:

  • Identify hydrophilic regions within the 129-amino acid sequence that are likely exposed

  • Focus on N-terminal or C-terminal regions that typically extend into aqueous environments

  • Avoid highly conserved regions if species-specificity is desired

  • Consider synthetic peptides representing predicted extracellular loops for antibody generation

• Antibody development considerations:

  • Develop antibodies against multiple epitopes to increase detection probability

  • Consider both polyclonal and monoclonal approaches for different applications

  • Test cross-reactivity with related CrcB proteins from other species

  • Validate antibody specificity using extracts from crcB knockout strains

• Application-specific optimization:

  • For Western blotting: Optimize membrane protein extraction and SDS-PAGE conditions

  • For immunolocalization: Develop fixation protocols that preserve membrane structure

  • For immunoprecipitation: Test detergents that maintain protein-protein interactions

  • For flow cytometry: Develop cell permeabilization protocols for accessing intracellular epitopes

• Technical challenges:

  • The multiple transmembrane domains may limit accessible epitopes

  • High salt requirements for protein stability (given the halophilic nature of the source organism )

  • Potential conformational changes under different ion concentrations

• Validation controls:

  • Epitope-tagged recombinant protein as positive control

  • Pre-immune serum as negative control

  • Peptide competition assays to confirm specificity

Given the specialized environmental adaptations of Idiomarina loihiensis, researchers should verify antibody performance under various buffer conditions, including different salt concentrations that might affect protein conformation.

How should researchers interpret transport activity data for CrcB homolog?

When analyzing transport data for the Idiomarina loihiensis CrcB homolog, researchers should consider multiple factors that could influence results:

• Data normalization approaches:

  • Normalize to protein expression levels using Western blot quantification

  • Calculate transport rates relative to positive controls (known transporters)

  • Consider time-dependent activity curves rather than single time points

  • Establish dose-response relationships for substrate and inhibitor studies

• Environmental parameters to consider:

  Parameter	Physiological Range	Experimental Consideration
  Temperature	4-46°C	Test activity across temperature range
  Salinity	0.5-20% NaCl	Include salt gradients in transport assays
  pH	Environmental pH variation	Test pH dependency of transport
  Membrane composition	Variable	Test in different lipid environments

• Potential artifacts and their mitigation:

  • Non-specific leakage (control with empty vesicles/cells)

  • Indirect effects through other transporters (use specific inhibitors)

  • Protein misfolding in heterologous systems (validate with multiple approaches)

  • Aggregation effects (assess protein oligomeric state)

• Kinetic analysis recommendations:

  • Determine Km and Vmax values for primary substrates

  • Assess competition kinetics with potential inhibitors

  • Calculate ion selectivity ratios for related ions

  • Consider electrochemical gradient effects on transport rates

• Statistical approaches:

  • Apply appropriate statistical tests for comparing conditions

  • Consider biological replicates (different protein preparations) in addition to technical replicates

  • Use time-series analysis for dynamic transport processes

  • Apply curve-fitting methods appropriate to transport mechanisms

When interpreting data, researchers should remember that Idiomarina loihiensis has evolved in an extreme environment with fluctuating conditions, which may result in activity profiles different from those of mesophilic homologs.

What approaches can resolve structural dynamics of CrcB homolog in native-like environments?

To investigate the structural dynamics of the CrcB homolog in conditions mimicking its native environment, researchers should consider these advanced methodologies:

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

  • Determine solvent-accessible regions in the native protein

  • Monitor conformational changes under different ion concentrations

  • Identify regions with altered dynamics upon substrate binding

  • Implement specialized detergent-compatible protocols for membrane proteins

• Single-molecule FRET (smFRET):

  • Engineer paired fluorophores at strategic positions within the 129-amino acid sequence

  • Monitor real-time conformational changes during transport cycles

  • Assess the effect of environmental variables (salt, temperature) on protein dynamics

  • Combine with liposome reconstitution for native-like membrane environment

• Solid-state NMR spectroscopy:

  • Isotopically label the protein for detailed structural analysis in lipid bilayers

  • Probe local dynamics at specific residues under varying conditions

  • Study protein-lipid interactions that may regulate function

  • Investigate ion binding sites through chemical shift perturbations

• Molecular dynamics simulations:

  • Build models incorporating the complete protein sequence

  • Simulate behavior in membranes mimicking extremophile composition

  • Assess ion permeation pathways and gating mechanisms

  • Calculate energetics of conformational changes

• Native mass spectrometry:

  • Determine oligomeric states under different environmental conditions

  • Identify potential regulatory molecules that co-purify with the protein

  • Study ligand binding using modified buffer conditions to maintain native interactions

When implementing these methods, researchers should account for the halophilic origin of Idiomarina loihiensis by including appropriate salt concentrations in buffers and considering how the extreme environment may have shaped protein dynamics.

How might understanding CrcB homolog function contribute to extremophile biotechnology?

Research on the Idiomarina loihiensis CrcB homolog has several potential biotechnological applications leveraging extremophile properties:

• Bioremediation technologies:

  • Development of fluoride bioremediation systems for contaminated water

  • Engineering extremophile-based biological sensors for environmental monitoring

  • Creating halotolerant strains with enhanced ion detoxification capabilities for industrial waste treatment

• Protein engineering applications:

  • Designing ion channels with enhanced stability for biosensor technologies

  • Creating chimeric transporters combining extremophile stability with mesophile specificity

  • Developing membrane proteins that function in non-conventional solvents for industrial biocatalysis

• Structural biotechnology:

  • Using the natural salt tolerance of CrcB homolog as a framework for designing stable membrane proteins

  • Identifying unique structural features that confer resistance to extreme conditions

  • Developing novel crystallization methods for challenging membrane proteins

• Synthetic biology opportunities:

  • Incorporating extremophile ion transporters into synthetic cells for enhanced environmental tolerance

  • Creating minimal cells with streamlined ion homeostasis systems based on CrcB function

  • Designing biological circuits responsive to environmental ion fluctuations

• Comparative systems biology approaches:

  • Mapping ion homeostasis networks across extremophiles to identify common principles

  • Developing predictive models for protein function in extreme environments

  • Identifying co-evolution patterns between transporters and cellular metabolism

Future research should leverage the complete genome sequence information available for Idiomarina loihiensis to explore system-wide adaptations related to ion homeostasis and membrane protein function in extreme environments.

What novel experimental techniques might advance understanding of CrcB homolog function?

Emerging technologies and methodological innovations that could significantly advance research on the CrcB homolog include:

• Cryo-electron tomography:

  • Visualize the CrcB homolog in its native membrane environment without crystallization

  • Determine in situ structural arrangements and interactions with other membrane components

  • Observe conformational states that may be disrupted during purification

• Nanobody-based research tools:

  • Develop conformation-specific nanobodies to stabilize and probe different functional states

  • Create intracellular nanobody biosensors to monitor protein dynamics in live cells

  • Use nanobodies as crystallization chaperones for structural studies

• Microfluidic platforms:

  • Develop gradient-generating systems to study function under dynamic environmental conditions

  • Create artificial cells with reconstituted membranes containing CrcB for transport studies

  • Implement high-throughput screening for functional variants or inhibitors

• In-cell structural biology:

  • Apply in-cell NMR techniques to study protein dynamics in living bacteria

  • Use genetically encoded crosslinkers to capture transient interactions

  • Implement proximity labeling methods to identify interaction partners in native contexts

• Advanced computational approaches:

  • Apply machine learning for improved prediction of transport mechanisms

  • Develop coarse-grained simulations to access longer timescales relevant to transport cycles

  • Implement quantum mechanical/molecular mechanical (QM/MM) methods to study ion coordination

• Genome editing in extremophiles:

  • Develop CRISPR-Cas systems optimized for Idiomarina loihiensis

  • Create libraries of genomically encoded variants for in vivo functional screening

  • Implement multiplex genome editing to study compensatory mechanisms

These advanced techniques, when applied to the 129-amino acid CrcB homolog protein , have the potential to reveal fundamental insights into ion transport mechanisms and extremophile adaptations that could inform both basic science and biotechnological applications.