Recombinant Idiomarina loihiensis UPF0060 membrane protein IL1642 (IL1642)
Description
Overview of Idiomarina loihiensis
Idiomarina loihiensis is a deep-sea, γ-proteobacterium initially isolated from a hydrothermal vent at a depth of 1,300 meters on the Lō'ihi submarine volcano off Hawaii . This bacterium is not an obligate anaerobic vent hyperthermophile like Thermotoga and Pyrococcus spp., and it can withstand a wide range of temperatures (4°C to 46°C) and salinities (0.5% to 20% NaCl) . The genome of I. loihiensis consists of a single chromosome comprising 2,839,318 base pairs, encoding 2,640 proteins, four rRNA operons, and 56 tRNA genes .
Genomic and Metabolic Features
Compared to other γ-proteobacteria, I. loihiensis exhibits an abundance of amino acid transport and degradation enzymes but a reduction in sugar transport systems and specific enzymes involved in sugar metabolism . This suggests that I. loihiensis relies more on amino acid catabolism rather than sugar fermentation for its carbon and energy needs . Although the genome encodes enzymes for synthesizing purines, pyrimidines, most amino acids, and coenzymes, the biosynthetic pathways for leucine, isoleucine, valine, threonine, and methionine are incomplete . Experiments have confirmed that I. loihiensis is auxotrophic for valine and threonine .
Role of Exopolysaccharides and Biofilms
Similar to other deep-sea vent microorganisms, I. loihiensis produces a highly viscous exopolysaccharide . The genome of I. loihiensis contains a cluster of 32 genes (IL0538–IL0569) that encode enzymes involved in the synthesis, export, modification, and polymerization of exopolysaccharides . There is also another gene cluster (IL0518–IL0521) that encodes enzymes for sialic acid biosynthesis and sialylation of surface polysaccharides .
Fatty Acid Composition
Idiomarina has a unique fatty acid composition characterized by a high percentage of iso-branched fatty acids . I. loihiensis has twice the percentage of saturated fatty acids compared to other Idiomarina species . A complete set of enzymes for fatty acid biosynthesis has been found in the I. loihiensis genome . Gas chromatography/MS analysis of membrane fractions identified 11 fatty acids, with the most abundant being 3-hydroxyoctadecanoic acid (24.7%), 3-hydroxyundecanoic acid (23.2%), 9-octadecenoic acid (19.3%), and hexadecanoic acid (11.2%) . These fatty acids were identified as esters of phosphatidylglycerol (PG), diphosphatidylglycerol (DPG), phosphatidylethanolamine (PE), phosphatidylserine (PS), and phosphatidylcholine (PC), with PG and DPG being the most abundant phospholipids (45.6% and 32.2%, respectively) .
Recombinant IL1642 Protein Information
Recombinant Full Length Idiomarina loihiensis UPF0060 membrane protein IL1642(IL1642) Protein, His-Tagged is a protein produced in E. coli with a His tag attached to the N-terminal . The protein sequence spans from 1 to 111 amino acids (AA) .
Table 1: Recombinant IL1642 Protein Details
| Category | Description |
|---|---|
| Catalog No. | RFL20415IF |
| Species | Idiomarina loihiensis |
| Source | E. coli |
| Tag | His |
| Protein Length | Full Length (1-111 AA) |
| Form | Lyophilized powder |
| AA Sequence | MSALFLMKTLGLFIATAIAEIVGCYLPYLWLKEGHSVWLLIPAAVSLALFAYLLTLHPAE SGRVYAAYGGIYVLTAIVWLRIVDKSPLSNFDLIGTAFVLTGMGILVYGWR |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles. |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. |
| Gene Name | IL1642 |
| Synonyms | IL1642; UPF0060 membrane protein IL1642 |
| UniProt ID | Q5QUB1 |
Potential Research Applications
Creative BioMart offers IL1642 proteins for research in the life sciences . While specific research findings directly involving the IL1642 protein are not detailed in the provided documents, its nature as a membrane protein in a bacterium adapted to extreme conditions suggests potential applications in:
-
Extremophile Research: Understanding the adaptations of organisms to extreme environments .
-
Membrane Protein Studies: Investigating the structure, function, and biogenesis of membrane proteins .
-
Enzyme Discovery: Exploring enzymes involved in exopolysaccharide synthesis, modification, and polymerization .
-
Antimicrobial Research: Discovering new antiparasitic and antimicrobial agents .
-
Marine-Inspired Compounds: Synthesis and evaluation of marine-inspired compounds .
Product Specs
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in your order notes if needed. We will fulfill requests to the best of our ability.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with an additional charge. Please contact us in advance to arrange this.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
The specific tag type will be determined during production. If you require a particular tag, please inform us, and we will prioritize its inclusion.
Target Background
KEGG: ilo:IL1642
STRING: 283942.IL1642
