Recombinant Idiomarina loihiensis UPF0060 membrane protein IL2332 (IL2332)

What is Idiomarina loihiensis and why is its UPF0060 membrane protein IL2332 significant?

Idiomarina loihiensis is a deep-sea γ-proteobacterium isolated from a hydrothermal vent at 1,300-meter depth on the Lōihi submarine volcano in Hawaii . This extremophile has adapted to survive in harsh conditions with specific metabolic capabilities. IL2332 is a membrane protein belonging to the UPF0060 family, consisting of 112 amino acids . The protein is significant because it represents adaptations to extreme environments including high pressure, salinity, and temperature fluctuations characteristic of deep-sea hydrothermal vents . As a membrane protein from an extremophile, IL2332 offers insights into how proteins function in harsh environments, potentially providing valuable information for biotechnological applications and understanding fundamental aspects of protein stability.

What is the genomic context of the IL2332 protein?

The IL2332 protein is encoded within the Idiomarina loihiensis genome, which comprises a single circular chromosome of 2,839,318 base pairs with an average G+C content of 47% . The genome encodes 2,640 predicted ORFs, four rRNA operons, and 56 tRNA genes . The UPF0060 membrane protein IL2332 is one of several membrane proteins encoded in this genome. Comparative genomics analysis reveals that I. loihiensis represents a distinct lineage among γ-Proteobacteria, branching from the "trunk" of the γ-proteobacterial tree after the Pseudomonas lineage but before the Vibrio cluster . The genomic neighborhood of IL2332 includes genes involved in diverse cellular functions, and understanding this context can provide insights into the protein's potential functional associations.

What are the structural characteristics of the IL2332 protein?

The IL2332 protein consists of 112 amino acids with the sequence: "MSVLLIAKTLGLFFITAIAEIIGCYLPYLWLKKDGSAWLLIPAAISLAVFAWLLTLHPAESGRVYAAYGGVYVVTALLWLKAVEGASLSTYDAVGAAFTLTGMAIIAVGWNH" . As a UPF0060 family membrane protein, it contains hydrophobic regions that facilitate its integration into the cell membrane. Structural prediction suggests multiple transmembrane domains with both hydrophobic and hydrophilic regions that determine its orientation in the membrane. The protein likely adopts an alpha-helical structure common to many membrane proteins, with specific regions responsible for its function, which remains to be fully characterized. The cysteine residue (C) at position 25 may be involved in disulfide bond formation or metal coordination, potentially contributing to protein stability in extreme environments.

How should the recombinant IL2332 protein be stored and handled?

The recombinant IL2332 protein should be stored at -20°C for regular use, or at -80°C for extended storage periods . The protein is typically supplied in a Tris-based buffer with 50% glycerol, which is optimized for stability . For liquid formulations, the typical shelf life is approximately 6 months when stored at -20°C/-80°C, while lyophilized forms can be stable for up to 12 months under the same conditions . It is not recommended to subject the protein to repeated freeze-thaw cycles, as this can compromise its structural integrity and activity . For working with the protein over short periods (up to one week), aliquots can be stored at 4°C . Proper handling practices should include minimizing exposure to proteases and maintaining appropriate buffer conditions to preserve the native structure of the membrane protein.

How does IL2332 contribute to the halo-adaptation mechanisms in Idiomarina loihiensis?

The IL2332 membrane protein likely plays a significant role in the adaptation of Idiomarina loihiensis to high-salinity environments. Comparative genomics of Idiomarina species revealed various genes involved in halo adaptations, including transporters and influx/efflux systems for elements such as Fe, Cu, Zn, Pb, and Cd . While the specific function of IL2332 hasn't been fully characterized, its membrane localization suggests it may participate in maintaining membrane integrity under high salinity conditions or function as part of the cellular response to osmotic stress. The protein could potentially contribute to ion homeostasis, a critical aspect of survival in saline environments. Research has shown that Idiomarina species possess a higher proportion of genes involved in protein metabolism than carbohydrate metabolism, indicating that proteinaceous substrates act as their major food source . This adaptation strategy may influence the function of membrane proteins like IL2332 in nutrient acquisition or cellular protection mechanisms.

What experimental approaches are most effective for studying IL2332 function in membrane systems?

For studying the function of IL2332 in membrane systems, several complementary approaches can be utilized:

• Cell-free expression systems: The ALiCE system has shown success with challenging membrane proteins, yielding up to 200 μg/mL without extensive optimization while maintaining functional activity . This approach allows for rapid production and analysis without the complications of cellular toxicity.

• Detergent solubilization: Using detergents like n-dodecyl-β-maltoside (DDM) can effectively extract IL2332 from membranes while preserving its structure and function . The protocol typically involves:

  • Centrifugation of crude lysate (16,000 x g, 20 min, 4°C)

  • Resuspension of the microsomal pellet in 2x PBS

  • Addition of equal volume of 1% w/v DDM

  • Incubation at room temperature for 30 minutes

  • Final centrifugation (16,000 x g, 30 min, 4°C) to collect solubilized protein

• Structural studies: Techniques such as X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy can elucidate the three-dimensional structure of IL2332, providing insights into its functional mechanisms.

• Functional assays: Depending on the hypothesized function (transporter, sensor, structural component), specific assays can be designed to measure activity, including ion flux assays, ligand binding studies, or membrane integrity assessments.

How does the amino acid sequence of IL2332 compare across Idiomarina species, and what can this tell us about evolutionary conservation?

While specific sequence comparison data for IL2332 across all Idiomarina species is not provided in the search results, comparative genomics of seven Idiomarina strains revealed 1,313 core genes related to salinity tolerance, stress response, antibiotic resistance, virulence factors, and drug targets . Analyzing the conservation of IL2332 among these species could reveal evolutionarily conserved domains critical for function versus regions that may have diverged for species-specific adaptations.

Conservation analysis would likely show higher preservation in transmembrane domains and functionally important regions, while loops and terminals might display greater variability. The presence of IL2332 in the core genome of Idiomarina would suggest an essential function, potentially related to the fundamental adaptations to marine and high-salinity environments. Genome islands detected in some Idiomarina species highlight the role of horizontal gene transfer in acquiring novel genes , raising questions about whether IL2332 was acquired through vertical inheritance or horizontal transfer. Understanding these evolutionary patterns can provide insights into the protein's functional importance and adaptation mechanisms in extreme environments.

What is the relationship between IL2332 and antimicrobial resistance in Idiomarina loihiensis?

Antimicrobial resistance (AMR) genes were found exclusively in Idiomarina loihiensis L2TR among the seven Idiomarina strains studied through comparative genomics . While IL2332 itself is not directly identified as an AMR gene, its function as a membrane protein could potentially interact with resistance mechanisms. The AMR genes found in I. loihiensis include:

• katG (catalase-peroxidase) that catalyzes the activation of isoniazid

• Elongation factor Tu conferring resistance to elfamycin antibiotics

• murA providing intrinsic resistance to fosfomycin

• Efflux RND transporter components

• Various tRNA ligases

• DNA gyrase subunit A (gyrA)

• Lipid A export permease/ATP-binding protein MsbA

As a membrane protein, IL2332 could potentially interact with efflux pumps or other membrane-based resistance mechanisms. Understanding the potential role of IL2332 in antimicrobial resistance would require functional studies to determine if it affects membrane permeability, participates in efflux pump assembly, or contributes to stress responses that enhance survival under antibiotic pressure. The accumulation of antibiotic resistance genes in genomic islands in I. loihiensis makes these regions vectors for resistance dissemination, promoting bacterial survival under antibiotic selective pressures .

What are the optimal expression systems for producing recombinant IL2332 protein?

Based on the available research, several expression systems can be considered for producing recombinant IL2332 protein, each with distinct advantages:

For IL2332 specifically, in vitro E. coli expression systems have been successfully used . The ALiCE cell-free expression system has demonstrated particularly promising results for membrane proteins, allowing functional expression without the challenges associated with cellular toxicity . For optimal production, consider:

• Choosing a vector with appropriate tags for detection and purification

• Optimizing expression conditions (temperature, induction time, inducer concentration)

• Developing an effective membrane protein extraction method

• Establishing proper refolding protocols if the protein forms inclusion bodies

What purification strategies are most effective for obtaining functional IL2332?

Purifying functional membrane proteins like IL2332 requires specialized approaches to maintain their native structure. Based on established membrane protein purification methods, the following strategy is recommended:

• Initial extraction: Solubilize the membrane fraction containing IL2332 using appropriate detergents. n-Dodecyl-β-maltoside (DDM) at 1% w/v has proven effective for membrane protein extraction while preserving function .

• Centrifugation-based separation:

  • Centrifuge crude lysate (16,000 x g, 20 min, 4°C)

  • Collect the pellet containing microsomes

  • Resuspend in 2x PBS buffer

  • Add detergent solution (e.g., 1% DDM)

  • Incubate at room temperature for 30 minutes

  • Perform final centrifugation (16,000 x g, 30 min, 4°C)

• Affinity chromatography: Utilize affinity tags (His-tag, FLAG-tag, etc.) for initial purification, employing mild elution conditions to maintain protein structure.

• Size exclusion chromatography: Further purify the protein based on its molecular size, which helps remove aggregates and contaminating proteins.

• Quality assessment: Verify protein purity using SDS-PAGE, Western blotting, and functional assays to ensure the purified protein retains its native structure and activity.

For IL2332 specifically, maintaining an appropriate detergent concentration throughout the purification process is crucial to prevent protein aggregation while avoiding excess detergent that could interfere with downstream applications.

How can researchers assess the functional activity of purified IL2332?

Assessing the functional activity of IL2332 requires consideration of its predicted role as a membrane protein. While the specific function of IL2332 remains to be fully characterized, several approaches can be employed to evaluate its activity:

• Structural integrity assessment:

  • Circular dichroism (CD) spectroscopy to analyze secondary structure composition

  • Fluorescence spectroscopy to evaluate tertiary structure

  • Thermal shift assays to determine protein stability under different conditions

• Membrane incorporation studies:

  • Reconstitution into liposomes or nanodiscs

  • Proteoliposome formation efficiency

  • Orientation analysis using protease protection assays

• Binding assays:

  • If IL2332 functions as a receptor or transporter, ligand binding studies using potential substrates

  • Surface plasmon resonance (SPR) to measure binding kinetics

  • Isothermal titration calorimetry (ITC) for thermodynamic binding parameters

• Functional reconstitution:

  • Ion flux measurements if IL2332 participates in ion transport

  • Membrane integrity assays in reconstituted systems

  • Interaction studies with other proteins in the Idiomarina loihiensis membrane proteome

The approach used for cannabinoid receptor (CB2) expressed in the ALiCE system provides a model for membrane protein activity assessment, where activity in crude lysate was comparable to purified protein from cellular expression systems , suggesting that similar comparative activity assays could be developed for IL2332 once its function is better understood.

How does IL2332 contribute to understanding extremophile adaptation mechanisms?

The IL2332 membrane protein offers valuable insights into how extremophiles adapt to harsh environments, particularly deep-sea hydrothermal vents. Idiomarina loihiensis was isolated from a depth of 1,300 meters at the Lōihi submarine volcano in Hawaii, an environment characterized by high pressure, temperature fluctuations, and unique geochemical properties .

IL2332, as a membrane protein, likely contributes to the organism's survival strategies in several ways:

• Membrane structural adaptation: The amino acid composition of IL2332 (MSVLLIAKTLGLFFITAIAEIIGCYLPYLWLKKDGSAWLLIPAAISLAVFAWLLTLHPAESGRVYAAYGGVYVVTALLWLKAVEGASLSTYDAVGAAFTLTGMAIIAVGWNH) features a high proportion of hydrophobic residues, which may contribute to maintaining membrane fluidity and integrity under extreme conditions.

• Halo-adaptation mechanisms: Comparative genomics of Idiomarina species revealed various genes involved in adaptation to saline environments, including transporters and element management systems . IL2332 may play a role in these processes, potentially contributing to ion homeostasis or osmotic stress response.

• Metabolic adaptation: The genome of I. loihiensis reveals a reliance on amino acid catabolism rather than sugar fermentation for carbon and energy . This unusual metabolic strategy represents an adaptation to the proteinaceous particles present in deep-sea hydrothermal vent waters. IL2332 might be involved in this specialized metabolism, potentially participating in amino acid or peptide transport across the membrane.

Studying IL2332 can therefore contribute to understanding how membrane proteins evolve to function under extreme conditions, with potential applications in biotechnology, biomaterial design, and synthetic biology.

What potential biotechnological applications exist for IL2332 or insights derived from its study?

The study of IL2332 and other proteins from extremophiles like Idiomarina loihiensis offers several promising biotechnological applications:

• Enzyme engineering: Understanding how IL2332 maintains structural integrity under extreme conditions can inform the design of stable enzymes for industrial processes that operate under harsh conditions.

• Membrane protein expression systems: The successful expression of IL2332 in systems like ALiCE provides a model for expressing other challenging membrane proteins, potentially accelerating drug discovery efforts targeting membrane proteins, which represent approximately 60% of current drug targets.

• Biomaterial development: Insights into the structural adaptations of IL2332 could inspire the development of novel biomaterials with enhanced stability under extreme conditions, including high pressure, temperature fluctuations, or high salinity.

• Biosensor technology: If IL2332 functions as a sensor or transporter, it could potentially be engineered into biosensors for detecting specific molecules in challenging environments or industrial processes.

• Bioremediation applications: Understanding the metal tolerance mechanisms of Idiomarina species, which possess various resistance proteins and transporters associated with heavy metals , could lead to biotechnological applications in environmental remediation of metal-contaminated sites.

• Novel antimicrobial strategies: The study of membrane proteins from extremophiles could reveal unique vulnerabilities or resistance mechanisms that inform the development of new antimicrobial compounds or strategies to overcome resistance.

How can IL2332 serve as a model for membrane protein research methodology?

IL2332 can serve as an excellent model system for membrane protein research methodology for several reasons:

• Size and complexity: With 112 amino acids , IL2332 is relatively small for a membrane protein, making it more manageable for structural studies while still presenting the challenges typical of membrane proteins.

• Expression optimization: The successful expression of IL2332 in recombinant systems provides a case study for optimizing the production of challenging membrane proteins. The approaches used, including buffer composition (Tris-based buffer with 50% glycerol) and expression conditions, can serve as starting points for other membrane protein studies.

• Purification workflow development: The extraction and purification methods established for IL2332 can inform protocols for other membrane proteins. The use of detergents like DDM for solubilization provides a methodological framework that can be adapted for similar proteins .

• Functional characterization approaches: As researchers develop methods to assess IL2332 function, these approaches can serve as templates for characterizing other membrane proteins of unknown function.

• Comparative analysis framework: The comparative genomics approach used to study Idiomarina species demonstrates how to contextualize individual membrane proteins within their genomic and evolutionary framework, providing a model for similar analyses of other membrane protein families.

• Integration of structural and functional studies: The comprehensive study of IL2332 from sequence to structure to function illustrates an integrated research approach that can be applied to other membrane proteins, particularly those from extremophiles or organisms with unique metabolic capabilities.