Recombinant Idionycteris phyllotis Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Idionycteris phyllotis Cytochrome b

Recombinant Idionycteris phyllotis Cytochrome b (MT-CYB) is a laboratory-produced protein that replicates the mitochondrial cytochrome b found in Allen's big-eared bat (Idionycteris phyllotis, also known as Corynorhinus phyllotis). This bat species inhabits the mountainous regions of the southwestern United States through central Mexico, primarily dwelling in caves within pine and oak forests . The recombinant form of this protein is produced through various expression systems for research purposes, typically consisting of the full or partial sequence of the native protein, often with additional tags to facilitate purification and detection .

The MT-CYB gene is located in the mitochondrial genome and encodes the cytochrome b protein, which serves as Component III of the ubiquinol-cytochrome c reductase complex (also known as complex III or the cytochrome b-c1 complex) that forms part of the mitochondrial respiratory chain . The recombinant version of this protein has emerged as a valuable tool for various scientific applications, including evolutionary studies, species identification, and research into mitochondrial function and diseases.

Taxonomic Context of Idionycteris phyllotis

Idionycteris phyllotis is a vespertilionid bat characterized by its distinctively large ears (34 to 43 mm) with lappets projecting from the base and extending over the forehead. The species has a total length of 103 to 118 mm, a tail length of 44 to 55 mm, and a forearm length of 42 to 49 mm. The wing span ranges from 302 to 344 mm, with long dorsal and ventral pelage (10 mm) that is basally black with yellowish gray tips. A notable white hair patch occurs at the base of the ears. Female specimens are generally about 5% larger in head and body length than males, though forearm lengths remain consistent between sexes .

This species is primarily insectivorous, feeding mostly on moths and stationary insects gleaned from surfaces. They are typically observed two to three hours after sunset near water sources, exhibiting swift, direct flight patterns in open areas and slow, highly maneuverable movements in confined spaces. Their echolocation signals are audible during open flight .

Three-Dimensional Structure

The three-dimensional structure of Idionycteris phyllotis Cytochrome b has been computationally modeled using AlphaFold. The model (identifier: AF-Q33537-F1) demonstrates high confidence scores with a pLDDT (predicted local distance difference test) global value of 97.93, indicating a highly reliable structural prediction. This model was released in the AlphaFold database on December 9, 2021, and last modified on September 30, 2022 .

The high confidence score suggests that the structure follows the conserved folding pattern typical of cytochrome b proteins, with transmembrane helical regions that anchor the protein within the inner mitochondrial membrane. While this is a computed model rather than an experimentally determined structure, the high pLDDT score suggests its close approximation to the actual protein conformation .

Expression Systems

Recombinant Idionycteris phyllotis Cytochrome b can be produced in various expression systems, each offering different advantages for protein folding, post-translational modifications, and yield. Available expression systems for this protein include:

  1. In vitro Escherichia coli expression system

  2. Yeast expression system

  3. Baculovirus expression system

  4. Mammalian cell expression system

  5. In vivo biotinylation in E. coli

The choice of expression system depends on the intended application, required protein purity, and structural authenticity needed. The E. coli system typically provides high yields but may lack certain post-translational modifications, while mammalian cell systems offer more authentic processing but with potentially lower yields .

Protein Tags and Purification

Recombinant versions of the protein often include affinity tags to facilitate purification and detection. Common tag types include:

  1. Histidine tags (His-tag)

  2. Biotin tags (through in vivo biotinylation)

  3. GST fusion tags

The specific tag type may be determined during the production process based on the intended application and desired purification strategy . These tags allow for easier isolation of the recombinant protein through affinity chromatography, enhancing purity for subsequent applications.

Phylogenetic and Evolutionary Studies

Cytochrome b is widely used in molecular phylogenetic studies, particularly for vertebrate taxa. Research comparing the utility of cytochrome b, COI, and nuclear ribosomal gene regions has shown that cytochrome b exhibits comparable levels of sequence variation and A/T bias to COI, although it may be less useful for recovering certain intergeneric relationships .

The MT-CYB gene has been particularly valuable in bat phylogenetic studies. Research on vespertilionid bats has employed mitochondrial markers, including cytochrome b, to elucidate phylogenetic relationships within the Vespertilioninae subfamily . These studies help clarify taxonomic classifications that were previously based solely on morphological characteristics, providing molecular evidence for evolutionary relationships.

Table 1: Comparison of Common Genes Used in Bat Phylogenetic Studies

GeneGenomeVariability LevelUtilityLimitations
Cytochrome b (MT-CYB)MitochondrialHighSpecies identification, Family-level phylogenyLess effective for intergeneric relationships
Cytochrome c oxidase I (COI)MitochondrialHighDNA barcoding, Species identificationSimilar limitations to cytochrome b
12S rRNAMitochondrialModerateHigher taxonomic relationshipsLower resolution at species level
16S rRNAMitochondrialModerateHigher taxonomic relationshipsLower resolution at species level
RAG2NuclearLow-ModerateDeep evolutionary relationshipsLower resolution for recent divergences

Species Identification and Conservation

The cytochrome b gene serves as an important molecular marker for species determination, particularly in wildlife forensics and conservation efforts. Its utility extends to the identification of species from poor-quality samples, such as powdered animal products or processed materials. The standard protocol involves DNA extraction, amplification of a portion of the cytochrome b gene using universal primers, and sequencing of the resulting fragment (typically around 486 bp). The sequences are then compared with voucher specimens or database entries for confident species identification .

This application is particularly valuable for monitoring illegal wildlife trade, including products derived from protected bat species. The technique allows forensic identification even when morphological characteristics have been obscured through processing or manufacturing .

Mitochondrial Disease Research

Research on mitochondrial diseases has explored using specifically designed oligoribonucleotides targeted into mitochondria to address heteroplasmy—the presence of both mutated and wild-type mitochondrial DNA within cells. Studies have demonstrated that oligoribonucleotides complementary to mutant mtDNA regions can specifically reduce the proportion of mtDNA bearing large deletions, such as those associated with Kearns Sayre Syndrome .

Recombinant cytochrome b proteins, including those from Idionycteris phyllotis, provide valuable tools for understanding mitochondrial genetic diseases and developing potential therapeutic approaches. Additionally, specific polymorphisms in the MT-CYB gene have been associated with conditions such as male infertility, highlighting the clinical relevance of research into this protein .

Related Research Resources

Several research resources complement the use of recombinant cytochrome b proteins:

  1. Computational structure models, such as those available through AlphaFold DB (AF-Q33537-F1)

  2. Sequence data accessible through UniProt (accession number Q33537)

  3. Antibodies targeting MT-CYB for immunological detection methods

  4. Protocols for species identification using cytochrome b sequencing

These resources collectively support a wide range of research applications in evolutionary biology, conservation, and mitochondrial function studies.

Conservation Across Species

Similarly, certain bee species (Apidae) demonstrate accelerated cytochrome b nucleotide and amino acid evolution, possibly correlated with increased metabolic rates associated with facultative endothermy (heterothermy) . These variations highlight how the protein may adapt to different metabolic requirements across species while maintaining its core function.

Specific Polymorphisms and Their Effects

Specific polymorphisms in the MT-CYB gene have been associated with functional consequences in various species. In humans, the single nucleotide polymorphism rs527236194 in the MT-CYB gene has been linked to asthenoteratozoospermia, a condition affecting sperm quality. Research has demonstrated that this polymorphism may contribute to male infertility, particularly in cases of idiopathic infertility .

These findings emphasize the importance of studying variations in the cytochrome b sequence across species and populations to understand both evolutionary relationships and potential functional implications.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have specific tag requirements, please inform us and we will prioritize development according to your specifications.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Idionycteris phyllotis (Allen's big-eared bat) (Corynorhinus phyllotis)
Target Names
Target Protein Sequence
MTNIRKSHPLLKIINKSFVDLPAPSNISSWWNFGSLLGICLMLQIMTGLFLAMHYTADTT TAFNSVTHICRDVNYGWMLRYLHANGASMFFICLYLHVGRGLYYGSYLYKETWNVGVLLL FTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLT
Uniprot No.

Target Background

Function
Cytochrome b, a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), is an integral part of the mitochondrial respiratory chain. The b-c1 complex facilitates electron transfer from ubiquinol to cytochrome c. This process contributes to the generation of a proton gradient across the mitochondrial membrane, which is subsequently utilized for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome b (MT-CYB) and why is it important in phylogenetic studies?

Cytochrome b (MT-CYB) is a mitochondrial gene that encodes a protein component of Complex III in the electron transport chain. This protein plays a crucial role in cellular respiration by facilitating electron transfer between complexes II and III. In phylogenetic studies, particularly those involving bat species like Idionycteris phyllotis, Cytochrome b has become an essential molecular marker for several reasons. It evolves at a relatively consistent rate, making it valuable for estimating divergence times between lineages. The gene contains both conserved regions (useful for higher taxonomic level comparisons) and variable regions (informative for species-level distinctions). Additionally, its maternal inheritance pattern and lack of recombination simplify evolutionary analyses .

Recent research has demonstrated the utility of Cytochrome b in resolving taxonomic uncertainties within bat families, particularly Vespertilionidae, which includes Idionycteris phyllotis. Partial sequences of this gene, often analyzed alongside other mitochondrial markers like COI, have revealed cryptic diversity and helped reconstruct evolutionary relationships among morphologically similar bat species .

What are the optimal storage conditions for recombinant Idionycteris phyllotis Cytochrome b?

For maximum stability and activity of recombinant Idionycteris phyllotis Cytochrome b, researchers should adhere to specific storage protocols. According to product specifications, the optimal storage conditions include:

  • Long-term storage: -20°C for standard preservation, with -80°C recommended for extended storage periods

  • Working solutions: Store at 4°C for up to one week to minimize protein degradation

  • Buffer composition: The protein is typically provided in a Tris-based buffer with 50% glycerol, specifically optimized to maintain protein stability

  • Freeze-thaw cycles: Repeated freezing and thawing should be strictly avoided as this significantly reduces protein activity

To maximize the lifespan of recombinant protein preparations, it is advisable to prepare small working aliquots from the stock solution upon receipt. This practice minimizes the number of freeze-thaw cycles experienced by any portion of the protein sample. Each aliquot should be clearly labeled with the date of preparation and number of previous thaws to ensure experimental reproducibility.

What technical considerations should be accounted for when working with MT-CYB gene sequences?

When analyzing MT-CYB gene sequences from Idionycteris phyllotis or related bat species, several technical considerations should be addressed to ensure accurate results:

First, researchers must implement appropriate codon position partitioning in phylogenetic analyses. Different substitution models may be required for different codon positions, as demonstrated in comprehensive studies of vespertilionid bats. For example, research has shown that first, second, and third codon positions of Cytochrome b often require different evolutionary models such as HKY+Γ, HKY+I, and TN+I, respectively .

Second, consideration of potential saturation, particularly at third codon positions, is essential. Saturation can obscure phylogenetic signal for deeper divergences and lead to incorrect topology inference. Appropriate substitution models that account for this phenomenon should be employed .

Third, researchers should be vigilant about nuclear mitochondrial pseudogenes (NUMTs), which can confound analyses if inadvertently amplified. Careful primer design and quality control measures are necessary to ensure targeted amplification of authentic mitochondrial sequences .

Finally, researchers should consider the potential for incongruence between mitochondrial and nuclear gene trees. The BioNJ ILD analysis and other statistical tests can help identify and quantify such incongruence, which may result from processes like incomplete lineage sorting or introgression .

What are the primary research applications of recombinant Idionycteris phyllotis Cytochrome b?

Recombinant Idionycteris phyllotis Cytochrome b serves numerous research applications in bat biology and broader evolutionary studies:

In phylogenetic and taxonomic research, the recombinant protein provides a standardized reference for comparative studies, particularly valuable when investigating the evolutionary relationships among vespertilionid bats. The protein sequence, consisting of 376 amino acids (with the recombinant version often representing positions 1-176), contains regions that are both conserved across species and variable between closely related taxa .

For immunological studies, the recombinant protein serves as an antigen for generating specific antibodies that can be used in various detection and localization assays. These antibodies enable researchers to study protein expression patterns across different bat tissues or under varying physiological conditions .

In biochemical characterization studies, the recombinant protein facilitates investigations of electron transport chain function in chiropterans, potentially revealing adaptations related to their unique metabolism and flight capabilities. The protein contains multiple transmembrane domains that anchor it in the inner mitochondrial membrane and highly conserved histidine residues that coordinate heme groups essential for electron transport .

As a standard in protein expression studies, the recombinant Cytochrome b allows for controlled comparisons of expression systems and post-translational modifications that might affect protein function across species or experimental conditions.

What methodological approaches are recommended for resolving phylogenetic incongruence when Cytochrome b shows conflict with nuclear genes?

Phylogenetic incongruence between mitochondrial genes like Cytochrome b and nuclear markers is a common challenge in bat systematics. Recent research offers several methodological approaches to address this issue:

Formal incongruence testing should be the first step. Statistical tests such as the BioNJ ILD (Incongruence Length Difference) test, NJ LILD (Localized Incongruence Length Difference) test, and modified Templeton test can identify and quantify incongruence between gene regions. In a recent study of Corynorhinus bats (closely related to Idionycteris), researchers detected significant topological conflict between nuclear (RAG2) and mitochondrial genes (Cytochrome b and COI) using these approaches .

When significant incongruence is detected, separate analysis of gene regions is recommended. The search results demonstrate that researchers analyzed mitochondrial and nuclear data separately after determining that RAG2 was causing topological incongruence. This approach allows researchers to evaluate conflicting signals independently before attempting combined analyses .

Different partition schemes should be explored to identify the most appropriate evolutionary model for each data subset. The study referenced in the search results compared "Best scheme" versus "Codon position" partitioning strategies and found that they yielded slightly different results, highlighting the importance of partition choice in phylogenetic analyses .

Mitogenomic approaches can provide more robust phylogenetic signals. By expanding from single genes to complete mitochondrial genomes, researchers can overcome limitations of individual gene analyses. In the referenced study, researchers confirmed their findings through mitochondrial phylogenomics, using entire mitogenomes to verify the relationships identified in single-gene analyses .

What statistical approaches are most effective for interpreting genetic distance data from Cytochrome b in vespertilionid bats?

Analysis of genetic distance data from Cytochrome b sequences requires sophisticated statistical approaches to extract meaningful biological information, particularly for vespertilionid bats with complex evolutionary histories:

Pairwise genetic distance calculation using appropriate substitution models is fundamental. Research on Corynorhinus species (relatives of Idionycteris) employed models such as HKY, TIM, or TN that account for the specific evolutionary patterns of Cytochrome b in bats. These analyses revealed significant genetic distances between populations, with some exceeding commonly accepted species thresholds .

Analysis of Molecular Variance (AMOVA) provides a powerful framework for quantifying genetic variation at different hierarchical levels. Table 2 from the search results illustrates a comprehensive AMOVA analysis that partitioned variation within populations, among populations within groups, and among groups. This approach revealed that 84-85% of genetic variation was explained by differences among major geographical groups, supporting their recognition as distinct evolutionary units .

HypothesisSource of variationd.f.sum of squaresVariance components% VariationFixation indexp-value
Two groups: SMO vs SMOC-TMVBAmong groups1461.66748.6806785.17Fct 0.851710.023
Among populations within groups8245.7946.6728811.67Fsc 0.78728< 0.001
Within populations3664.9081.803013.15Fst 0.96845< 0.001
Total45772.37057.15656
Three groups: SMO vs SMOC vs TMVBAmong groups2624.54823.3764984.27Fct 0.842740.003
Among populations within groups782.9132.559079.23Fsc 0.58666< 0.001
Within populations3664.9081.803016.50Fst 0.93500< 0.001
Total45772.37027.73856

Population structure analyses using methods such as GENELAND and STRUCTURE help identify genetic discontinuities and assign individuals to populations. These approaches incorporate spatial data and prior information about sampling locations to improve population assignment accuracy. In the referenced study, these methods successfully identified distinct genetic clusters corresponding to geographical regions .

Haplotype network analysis, implemented through software such as POPART using the Median Joining algorithm, visually represents relationships among haplotypes and identifies potential geographic structuring. The research described in the search results used this approach to reveal three distinct haplogroups of Corynorhinus mexicanus, with substantial mutational steps separating the northern SMO haplogroup from the others .

How do researchers determine appropriate substitution models for Cytochrome b phylogenetic analyses?

Selecting appropriate substitution models is critical for accurate phylogenetic reconstruction using Cytochrome b sequences. Recent research in bat phylogenetics demonstrates a sophisticated approach to model selection:

Partition-specific model selection is essential, as different regions of the Cytochrome b gene may evolve under different constraints. The research described in the search results employed a partitioning strategy that separated the data by codon position, with each position assigned its own evolutionary model. Table 1 from the search results illustrates this approach, showing different substitution models for each codon position (e.g., HKY+Γ for 1st positions, HKY+I for 2nd positions, and TN+I for 3rd positions of Cytochrome b) .

Information criteria provide objective measures for model selection. The Bayesian Information Criterion (BIC) was used in the referenced study to identify optimal substitution models for each partition. This approach balances model complexity with goodness-of-fit to avoid overfitting .

Comparison of different partition schemes allows researchers to assess the impact of partitioning decisions on phylogenetic inference. The study compared two partition schemes: "Codon position," which separated each codon position for each gene, and "Best scheme," which combined certain codon positions across genes based on similar evolutionary patterns (e.g., grouping 1st positions of Cytochrome b with 3rd positions of COI) .

Testing alternative models through likelihood ratio tests or Bayes factors can provide additional confidence in model selection. While not explicitly mentioned in the search results, this approach is commonly used in conjunction with information criteria to validate model choices.

What are the current challenges in interpreting mitochondrial genetic data like Cytochrome b for species delimitation?

Species delimitation using mitochondrial markers like Cytochrome b faces several significant challenges that researchers must address through careful experimental design and data interpretation:

Mitochondrial introgression can lead to misleading phylogenetic signals. Historical hybridization events can result in the capture of mitochondrial genomes from one species by another, creating discordance between mitochondrial gene trees and the true species tree. In the bat study described in the search results, the researchers had to consider whether the observed polyphyly of Corynorhinus mexicanus reflected cryptic species diversity or mitochondrial introgression .

Incomplete lineage sorting, particularly in recent or rapid radiations, causes gene trees to differ from species trees. Ancestral polymorphisms may persist across speciation events, complicating the interpretation of mitochondrial data. This phenomenon must be considered when evaluating the unexpected finding that some populations of C. mexicanus were genetically closer to C. townsendii than to conspecific populations .

Threshold problems make species delimitation based on genetic distances subjective. The search results show that genetic distances between populations of C. mexicanus (12.8-13.87%) exceeded those between recognized species (7.8-12.7% between C. mexicanus and C. townsendii), but determining whether these distances warrant species-level recognition remains challenging without established thresholds for vespertilionid bats .

Nuclear mitochondrial DNA segments (NUMTs) can be inadvertently amplified, leading to conflicting signals. While not specifically mentioned in the search results, this is a well-known challenge in mitochondrial DNA analysis that requires careful primer design and sequence verification to avoid.

What advantages does next-generation sequencing offer for Cytochrome b studies compared to traditional Sanger sequencing?

Next-generation sequencing (NGS) technologies provide several significant advantages over traditional Sanger sequencing for Cytochrome b studies in bat research:

Complete mitogenome sequencing becomes feasible with NGS approaches. The search results describe how researchers used Illumina next-generation sequencing to obtain entire mitochondrial genomes from representative individuals of different lineages of Corynorhinus mexicanus. This comprehensive approach allowed them to confirm the phylogenetic patterns observed in single-gene analyses and provided greater resolving power for evolutionary relationships .

Increased depth of coverage with NGS improves sequence accuracy and helps identify rare variants or heteroplasmy. While traditional Sanger sequencing typically provides a consensus sequence that may mask low-frequency variants, NGS captures the full spectrum of sequence variation present in a sample.

Multiplexing capabilities allow simultaneous analysis of numerous samples, increasing throughput and reducing per-sample costs. This efficiency enables more comprehensive sampling of populations across geographic ranges, which is crucial for accurate phylogeographic inference.

Detection of nuclear mitochondrial pseudogenes (NUMTs) is enhanced with NGS. The depth of coverage and ability to observe mapping patterns can help distinguish authentic mitochondrial sequences from nuclear copies, reducing the risk of confounding results.

Mitogenomic approaches enable more sophisticated phylogenetic analyses. As demonstrated in the search results, researchers were able to establish a partition scheme consisting of 38 partitions across the mitogenome, including separate partitions for ribosomal RNAs, transfer RNAs, and each codon position of protein-coding genes. This fine-grained approach increases the accuracy of phylogenetic reconstruction .

What are the optimal PCR conditions for amplifying Cytochrome b from bat tissue samples?

Successful amplification of Cytochrome b from bat tissue samples requires carefully optimized PCR conditions. Based on recent research protocols, the following conditions are recommended:

For DNA extraction, specialized kits such as the ReliaPrepTM gDNA Tissue Miniprep System provide high-quality template DNA. Tissue samples should yield DNA at a concentration of 50-200 ng/μl, with final resuspension in molecular grade water rather than elution buffers that might interfere with downstream applications .

PCR reaction components for a standard 25 μl reaction should include 2 μl of template DNA (50-200 ng/μl), 1 μl of each primer at 10 mM concentration, 15 μl of a high-quality master mix (such as Master Mix RED from AMPLIQON®), and 6 μl of PCR-grade water. This composition provides a good balance of template concentration and reagent availability .

Primer selection is critical for successful amplification. Specific primers designed for vespertilionid bats have been developed and validated in previous studies. The exact primer sequences should be selected based on the specific research question and target region within the Cytochrome b gene .

Thermal cycling conditions typically include an initial denaturation at 94-95°C for 2-5 minutes, followed by 30-35 cycles of denaturation (94-95°C for 30-60 seconds), annealing (50-56°C for 30-60 seconds, with temperature optimized for specific primers), and extension (72°C for 60-90 seconds). A final extension at 72°C for 5-10 minutes completes the protocol .

Quality control measures should include negative controls (no template) in each PCR run to check for contamination. Post-amplification, products should be sequenced in both directions using both forward and reverse PCR primers to ensure sequence accuracy .

How should researchers approach experimental design when investigating cryptic species using Cytochrome b?

Investigation of cryptic species using Cytochrome b requires a carefully planned experimental design that incorporates multiple analytical approaches:

Comprehensive geographic sampling is essential for detecting cryptic diversity. The bat study referenced in the search results included samples from across the distribution range of Corynorhinus mexicanus, spanning multiple mountain ranges and biogeographic regions. This extensive sampling revealed previously unrecognized genetic diversity, with populations from the northern Sierra Madre Oriental (SMO) forming a distinct lineage that likely represents a cryptic species .

Multi-locus approach strengthens species delimitation hypotheses. While Cytochrome b provides valuable information, researchers should incorporate additional mitochondrial markers (such as COI) and, ideally, nuclear genes (such as RAG2) to test for concordance across independent loci. The study described in the search results used this approach, though they found significant incongruence between mitochondrial and nuclear markers .

Population genetic analyses help quantify differentiation between putative cryptic species. Methods such as Analysis of Molecular Variance (AMOVA), haplotype network analysis, and population structure analyses provide complementary perspectives on genetic differentiation. The research documented in Table 2 demonstrated that 84-85% of genetic variation was attributable to differences among major geographical groups, supporting their recognition as distinct evolutionary units .

Comparative genetic distance analysis provides context for species-level distinctions. By comparing genetic distances within and between recognized species, researchers can assess whether the observed differentiation is consistent with species-level divergence. The bat study found that genetic distances between some populations of C. mexicanus (12.8-13.87%) exceeded those between recognized species (7.8-12.7% between different populations of C. mexicanus and C. townsendii) .

Phylogenetic analysis using multiple inference methods increases confidence in evolutionary relationships. Both Maximum Likelihood and Bayesian Inference approaches, implemented with different partition schemes, should be used to assess the robustness of phylogenetic hypotheses. In the referenced study, both methods supported the polyphyly of C. mexicanus, with northern populations forming a distinct clade .

What controls should be included when using recombinant Idionycteris phyllotis Cytochrome b in protein-based assays?

When using recombinant Idionycteris phyllotis Cytochrome b in protein-based assays such as ELISAs or functional studies, several controls should be incorporated to ensure valid and reliable results:

Positive controls should include known concentrations of the recombinant protein to establish a standard curve for quantitative assays. Additionally, samples previously confirmed to contain Cytochrome b or to react with the assay should be included as references. For cross-reactivity studies, commercially available Cytochrome b from related species (particularly Corynorhinus species, given the historical taxonomic placement of Idionycteris within Corynorhinus) should be tested .

Negative controls are essential to establish assay specificity. These should include buffer-only wells (no protein), non-specific proteins of similar size and properties to test for cross-reactivity, and samples known to be negative for the target or antibody. These controls help establish the background signal and specificity of the assay .

Specificity controls help validate antibody-based detection methods. For immunoassays, pre-absorption of antibodies with recombinant protein can confirm specificity. Competitive binding assays and cross-reactivity testing with Cytochrome b from other bat species provide additional validation of assay specificity .

Technical controls ensure reproducibility and reliability. All samples should be tested in duplicate or triplicate to assess variability. Inter-assay calibrators should be included to account for plate-to-plate variation, and dilution series should be prepared to ensure linearity in the working range of the assay .

Storage condition controls may be necessary given the stability requirements of the recombinant protein. Comparisons of freshly thawed protein with protein stored at 4°C for various periods can help establish the stability profile and optimal handling procedures for experimental work .

How can researchers optimize DNA extraction protocols for obtaining high-quality Cytochrome b sequences from bat tissue samples?

Obtaining high-quality DNA for Cytochrome b sequencing from bat tissue samples requires optimized extraction protocols tailored to the specific challenges of chiropteran samples:

Selection of appropriate tissue types significantly impacts DNA quality. Muscle, liver, or wing punch biopsies typically yield good results for bat samples. The study described in the search results successfully extracted DNA from tissue samples, though the specific tissue type wasn't specified. Wing punches are particularly valuable for non-lethal sampling of bats .

Commercial extraction kits specifically designed for animal tissues provide consistent results. The researchers used the ReliaPrepTM gDNA Tissue Miniprep System from PROMEGA®, following the manufacturer's protocol but with a modification in the final step—resuspending in molecular grade water rather than the provided elution buffer. This modification may help avoid potential inhibition of downstream enzymatic reactions .

Sample preservation methods affect DNA quality. Tissues should be preserved in ethanol, RNAlater, or frozen immediately after collection. Degraded samples may require specialized extraction protocols or yield shorter fragments that necessitate alternative primer strategies.

Quality control assessments should be performed post-extraction. DNA concentration (ideally 50-200 ng/μl for PCR applications) and purity should be measured using spectrophotometric methods. Gel electrophoresis can confirm the presence of high-molecular-weight DNA and assess degradation .

Optimization for difficult samples may be necessary. For degraded samples, modified protocols with shorter extraction times or specialized buffers may improve results. For samples with PCR inhibitors, additional purification steps or the use of PCR additives like BSA may enhance amplification success.

What methodological approaches should be used when integrating Cytochrome b data with morphological characters for species delimitation?

Integrative taxonomy, combining molecular data from markers like Cytochrome b with morphological characters, provides a robust framework for species delimitation in bats. Researchers should employ several methodological approaches:

Statistical testing of character correlation helps identify morphological traits that correspond to genetic lineages. Discriminant function analysis or principal component analysis can be used to assess whether genetically distinct groups also differ morphologically. While not explicitly mentioned in the search results, this approach is essential for translating genetic findings into practical taxonomic tools .

Quantitative morphometrics provide objective measures of morphological variation. Traditional and geometric morphometric techniques can detect subtle morphological differences between cryptic species that might be missed in qualitative assessments. These approaches are particularly valuable for bat taxonomy, where cryptic diversity is common.

Character mapping on molecular phylogenies allows evaluation of morphological character evolution. By reconstructing ancestral character states and identifying synapomorphies, researchers can determine which morphological features reflect phylogenetic relationships revealed by Cytochrome b data. This approach helps distinguish between ancestral traits and derived characters useful for species diagnosis.

Assessment of character variation within and between genetic lineages is essential for establishing diagnostic morphological criteria. The search results suggest that researchers found genetically distinct lineages within Corynorhinus mexicanus that may represent different species, but the integration with morphological data was not detailed in the provided information .

Multivariate statistical approaches that simultaneously analyze molecular and morphological data can provide comprehensive evidence for species boundaries. Methods such as Bayesian clustering algorithms can incorporate both data types to identify cohesive evolutionary units that may represent distinct species.

How should researchers interpret contradictory phylogenetic signals between Cytochrome b and nuclear genes?

When confronted with contradictory signals between Cytochrome b and nuclear genes, researchers must employ rigorous analytical approaches and consider multiple biological explanations:

Formal incongruence testing provides a statistical framework for evaluating discordance. The bat study referenced in the search results employed several tests, including BioNJ ILD (Incongruence Length Difference), NJ LILD (Localized Incongruence Length Difference), and modified Templeton tests. These analyses revealed significant topological conflict between the nuclear gene RAG2 and mitochondrial genes (Cytochrome b and COI) .

Biological explanations for incongruence should be systematically evaluated. Incomplete lineage sorting often occurs in recent or rapid diversification and leads to retention of ancestral polymorphisms. Introgression or hybridization can result in mitochondrial capture, where the mitochondrial genome of one species is present in the nuclear background of another. Selection on mitochondrial genes can also create discordant patterns .

Separate analysis of mitochondrial and nuclear datasets is recommended when significant incongruence is detected. The researchers in the bat study found that RAG2 was causing topological incongruence and therefore conducted phylogenetic analyses using mitochondrial data only. This approach acknowledges the different evolutionary histories of nuclear and mitochondrial genomes .

Localization of incongruence helps identify specific relationships affected by discordance. The NJ LILD test showed that most of the topological incongruence occurred in clades corresponding to Corynorhinus townsendii and the SMOC and TMVB groups of C. mexicanus. This information guided the researchers' interpretation of evolutionary relationships .

What bioinformatic pipelines are recommended for analyzing Cytochrome b sequence data from vespertilionid bats?

Analysis of Cytochrome b sequence data from vespertilionid bats requires a comprehensive bioinformatic pipeline that incorporates multiple software tools and analytical approaches:

Initial sequence processing should include quality control, editing, and alignment. The bat study used SEQUENCHER® for editing raw sequence data and Clustal W implemented in MEGA X for sequence alignment. These steps ensure high-quality sequences and proper homology assessment before further analyses .

Haplotype identification and network analysis provide visualization of relationships among sequences. The researchers used DnaSP v. 6 to identify haplotypes present in their Cytochrome b dataset and POPART v. 1.7 to generate haplotype networks using the Median Joining algorithm. These analyses revealed three geographically structured haplogroups within Corynorhinus mexicanus .

Population genetic analyses quantify differentiation and test demographic hypotheses. The study employed DnaSP for calculating population genetic statistics and testing neutrality (Tajima's D and Fu's Fs). GENELAND v. 4.9.2 and STRUCTURE v. 2.3.4 were used to infer population structure and assign individuals to genetic clusters. These analyses supported the recognition of distinct evolutionary units .

Phylogenetic analysis should employ both Maximum Likelihood and Bayesian approaches. The researchers used BEAST2 for Bayesian Inference and IQTREE2 for Maximum Likelihood phylogenetic reconstruction. They tested different partition schemes and substitution models to ensure robust results. The MLSTests software was used for incongruence testing between gene regions .

Mitogenomic approaches provide additional phylogenetic resolution. The study expanded beyond single-gene analyses by sequencing complete mitochondrial genomes using Illumina next-generation sequencing. This approach allowed for more sophisticated analyses, with the mitogenome divided into 38 partitions representing different functional regions .

How can researchers effectively analyze population structure using Cytochrome b data from bat species?

Population structure analysis using Cytochrome b data requires a multi-faceted approach that incorporates several complementary methods:

Haplotype network analysis provides a visual representation of genetic relationships. The bat study identified 16 Cytochrome b haplotypes that clustered into three geographical regions: northern Sierra Madre Oriental (SMO), Sierra Madre Oriental Center (SMOC), and Trans-Mexican Volcanic Belt (TMVB). The network revealed 102 mutational steps between the SMO haplogroup and the other two groups, suggesting deep divergence .

Spatial genetic analysis incorporates geographic information into population structure inference. The researchers used GENELAND v. 4.9.2, a method that explicitly accounts for spatial data, to infer genetic discontinuities between populations. They tested from k = 1 to k = 10 subdivisions, performing ten independent runs for each condition with 1 million generations .

Bayesian clustering algorithms assign individuals to populations based on genetic similarity. The study employed STRUCTURE v. 2.3.4 under an admixed and LocPrior model, which uses sampling location information as a prior to improve clustering when the signal is weak. Population assignment was performed with 1 million generations and a thinning of 1000 .

Genetic distance calculation provides a quantitative measure of differentiation. Pairwise genetic distances using Cytochrome b differed significantly among the SMO, SMOC, and TMVB groups. The samples from SMO showed greater distances relative to those from the TMVB (12.8 ± 0.4%) and SMOC (13.87 ± 0.2%), while the lowest distance was between the TMVB and SMOC (2.7 ± 0.3%) .

What are the best practices for analyzing Cytochrome b codon positions in phylogenetic studies?

Codon position analysis is critical for accurate phylogenetic inference using protein-coding genes like Cytochrome b. Recent research demonstrates several best practices:

Partition by codon position to account for varying evolutionary rates. The bat study employed a "Codon position" partition scheme that separated each codon position of Cytochrome b, recognizing that these positions evolve under different constraints. First positions typically show intermediate variation, second positions are most conserved, and third positions evolve most rapidly .

Apply appropriate substitution models to each codon position. Table 1 from the search results shows the models selected for each position: HKY+Γ for 1st positions, HKY+I for 2nd positions, and TN+I for 3rd positions of Cytochrome b. These models account for the specific patterns of nucleotide substitution and rate heterogeneity at each position .

Consider alternative partition schemes that may better fit the data. The researchers compared their "Codon position" scheme with a "Best scheme" approach that combined certain codon positions across genes based on similar evolutionary patterns. The "Best scheme" grouped 1st positions of Cytochrome b with 3rd positions of COI, 2nd positions of Cytochrome b with 1st positions of COI, and 3rd positions of Cytochrome b with 2nd positions of COI .

Use information criteria to select optimal models and partitioning strategies. The Bayesian Information Criterion (BIC) was used in conjunction with the PartitionFinder algorithm to identify the best combination of partitions and substitution models. This approach balances model complexity with goodness-of-fit .

How can researchers integrate findings from Cytochrome b studies with broader conservation and taxonomic frameworks?

Integration of Cytochrome b findings with conservation and taxonomic frameworks requires careful consideration of multiple factors:

Genetic distance thresholds should be evaluated in the context of the taxonomic group. The research found that genetic distances between some populations of C. mexicanus (12.8-13.87%) exceeded those between recognized species (7.8-12.7% between different populations of C. mexicanus and C. townsendii). These comparisons provide context for interpreting genetic differentiation in terms of species-level distinctions .

Conservation implications of cryptic diversity should be explicitly addressed. The discovery of distinct evolutionary lineages within what was previously considered a single species has important conservation implications. Each lineage may have different ecological requirements, population sizes, and threats, necessitating tailored conservation strategies.

Biogeographic patterns should inform conservation planning. The study identified three geographically structured genetic groups associated with different mountain ranges in Mexico: the northern Sierra Madre Oriental (SMO), Sierra Madre Oriental Center (SMOC), and Trans-Mexican Volcanic Belt (TMVB). These distinctive biogeographic patterns can guide the development of regional conservation priorities .

Communication with taxonomic authorities and conservation agencies ensures that research findings translate into practical outcomes. While not explicitly mentioned in the search results, this step is crucial for implementing research-based taxonomic revisions and conservation measures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.