Recombinant Illicium oligandrum Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If you require a particular tag, please specify it; we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-314
Protein Length
Full Length of Mature Protein
Species
Illicium oligandrum (Star anise)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPNTVFEAVVRIPYDMQLKQV LANGKRGGLNVGAVLILPEGFELAPPDRISPEMKEKMGNLSFQNYRPTKRNILVIGPVPG QKYSEIVFPILSPDPATKKEVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATGAGLVS KIVRKEKGGYEITIADASDGHQAVDIIPPGPELLVSEGEYIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF
Uniprot No.

Target Background

Function

Recombinant Illicium oligandrum Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

How is the petA gene organized within the chloroplast genome of Illicium species?

The petA gene in Illicium species is located within the large single copy (LSC) region of the chloroplast genome. Based on comparative genomic analyses of chloroplast genomes within the Illicium genus, the gene maintains a highly conserved position and organization across related species including I. verum and I. difengpi.

Key features of petA organization in Illicium chloroplast genomes:

  • The gene is entirely contained within the LSC region

  • Positioned in proximity to other photosynthetic genes in a conserved arrangement

  • Contains no introns (characteristic of most chloroplast genes)

  • Flanked by conserved intergenic regions that may contain regulatory elements

The chloroplast genomes of I. verum and I. difengpi (and likely I. oligandrum) are approximately 142,689 bp in length, with the gene content highly conserved among Illicium species. Each chloroplast genome typically contains 79 protein-coding genes, 8 ribosomal RNA genes, and 35 transfer RNA genes .

What are the structural homologies between Illicium oligandrum Apocytochrome f and other characterized cytochromes?

Apocytochrome f from Illicium oligandrum shares significant structural similarities with other c-type cytochromes, particularly those from related plant species. The protein exhibits the characteristic domain organization common to cytochrome f proteins:

  • An N-terminal domain containing the heme-binding site (CXXCH motif)

  • A small hydrophobic domain anchoring the protein to the thylakoid membrane

  • A large hydrophilic domain extending into the thylakoid lumen

Structural comparison reveals that the arrangement of secondary structure elements is highly conserved, including:

  • β-sheet regions forming the core structural scaffold

  • α-helical regions containing catalytic and interaction sites

  • Loop regions that may confer species-specific functions

The high conservation of structure reflects the critical role of cytochrome f in photosynthetic electron transport, a fundamental process that has been conserved throughout the evolution of photosynthetic organisms .

What expression systems are most effective for producing functional recombinant Illicium oligandrum Apocytochrome f?

The expression of functional recombinant Apocytochrome f from Illicium oligandrum requires careful consideration of expression systems to ensure proper folding, post-translational modification, and functional activity. Based on research with similar cytochromes, several expression systems can be evaluated:

Bacterial Expression Systems:

  • E. coli BL21(DE3) with specialized vectors (pET series) can be used for high-yield expression

  • Co-expression with cytochrome maturation factors (Ccm system) is essential for proper heme attachment

  • Expression at lower temperatures (16-20°C) improves proper folding

  • Inclusion of solubility-enhancing tags (MBP, SUMO) can improve recovery of soluble protein

Yeast Expression Systems:

  • Pichia pastoris offers advantages for membrane protein expression

  • The presence of eukaryotic folding machinery improves proper folding

  • Inducible promoters (AOX1) allow controlled expression

  • Secretory pathway can be leveraged with appropriate signal sequences

Plant-Based Expression Systems:

  • Transient expression in Nicotiana benthamiana using viral vectors

  • Chloroplast transformation in model plants (tobacco, Chlamydomonas)

  • Cell-free expression systems using plant extracts

For Illicium oligandrum Apocytochrome f, the recommended approach involves:

  • Initial screening in E. coli with Ccm co-expression

  • Optimization of expression conditions (temperature, induction timing, media composition)

  • Purification under non-denaturing conditions using affinity chromatography

  • Verification of proper folding and heme incorporation using spectroscopic methods .

How can researchers effectively study the interaction between Apocytochrome f and cytochrome maturation proteins?

Studying interactions between Apocytochrome f and cytochrome maturation proteins requires sensitive techniques capable of detecting potentially transient and weak interactions. Several methodological approaches are recommended:

Yeast Two-Hybrid System:

  • Enables detection of direct protein-protein interactions

  • The D1 domain of cytochrome maturation proteins (containing RCXXC motifs) can be tested against Apocytochrome f

  • Controls should include testing interactions with empty vectors and unrelated proteins

  • Quantification can be performed using reporter genes (e.g., lacZ)

This approach has been successfully used to demonstrate interactions between AtCCMH (containing RCXXC motifs) and apocytochromes, with D1 domain interactions showing signals approximately 10 times higher than background levels .

Co-Immunoprecipitation:

  • Requires antibodies specific to either Apocytochrome f or maturation proteins

  • Can be challenged by the transient nature of interactions

  • Crosslinking protocols may help stabilize interactions

  • Western blotting confirmation enhances specificity

In vitro Binding Assays:

  • Pull-down assays using recombinant tagged proteins

  • Surface plasmon resonance to measure binding kinetics

  • Isothermal titration calorimetry for thermodynamic parameters

Functional Complementation Studies:

  • Expression of Illicium oligandrum Apocytochrome f in systems lacking native cytochrome f

  • Co-expression with various maturation factors

  • Assessment of functional restoration through activity assays

A comprehensive experimental design would include multiple approaches to overcome the challenges of detecting potentially transient interactions that occur during the cytochrome maturation process .

What methods are most suitable for analyzing the redox properties of Illicium oligandrum Apocytochrome f?

Analysis of the redox properties of Apocytochrome f requires specialized techniques to characterize electron transfer capabilities and redox potential. Recommended methodological approaches include:

Spectroelectrochemical Analysis:

  • Enables determination of redox potential

  • Requires specialized thin-layer electrochemical cells

  • Monitors absorbance changes during controlled potential electrolysis

  • Data analysis using the Nernst equation to calculate midpoint potentials

Protein Film Voltammetry:

  • Immobilizes protein on electrode surfaces

  • Provides direct measurement of electron transfer kinetics

  • Enables assessment of pH and temperature effects on redox properties

  • Can detect multiple redox-active centers

Direct Redox Assays:

  • Using chemical reductants (dithiothreitol, sodium dithionite)

  • Monitoring reduction of model substrates (e.g., synthetic peptides containing disulfide bonds)

  • Quantification via reverse phase chromatography and mass spectrometry

A study using similar methodology demonstrated that reduced forms of cytochrome maturation proteins containing RCXXC motifs could reduce intramolecular disulfide bridges in model peptides representing the heme-binding motif of apocytochromes. This approach provides valuable insights into the redox capabilities of these proteins .

Redox-Sensitive Fluorescent Probes:

  • Attachment of redox-sensitive fluorophores

  • Real-time monitoring of redox state changes

  • Potential for in vivo studies in reconstituted systems

For comprehensive characterization, researchers should employ multiple complementary techniques to establish a complete redox profile of Illicium oligandrum Apocytochrome f.

How does Illicium oligandrum Apocytochrome f compare to homologs from other Illicium species?

Comparative analysis of Apocytochrome f across Illicium species reveals important insights into evolutionary conservation and potential functional adaptations. While specific sequence data for I. oligandrum Apocytochrome f is available , comparative analysis with other Illicium species demonstrates several key patterns:

Sequence Conservation:
The high degree of conservation in the petA gene across Illicium species reflects the fundamental importance of cytochrome f in photosynthetic electron transport. Key functional regions show particularly strong conservation:

  • Heme-binding motifs

  • Transmembrane domains

  • Substrate interaction sites

Comparative Analysis of Illicium Species Chloroplast Genomes:

FeatureI. verumI. difengpiI. oligandrum (predicted)
Genome Size142,689 bp142,689 bp~142,000-143,000 bp
IR Length~21,700-22,000 bp~21,700-22,000 bp~21,700-22,000 bp
Gene Content122 genes122 genes~122 genes
SSR Content10496Not determined
Long Repeats2625Not determined

The IR boundaries and adjacent genes show significant conservation across Illicium species, with petA maintaining consistent positioning within the LSC region .

  • I. oligandrum is found in forests and thickets at elevations of 700-1200 m in Guangxi and Hainan, China

  • The species demonstrates distinctive morphological characteristics, growing as trees up to 12 m tall with oblong-obovate to elliptic leaves

  • These ecological adaptations may correlate with specific functional adaptations in photosynthetic proteins including Apocytochrome f

What phylogenetic insights can be gained from studying petA gene sequences within the Illicium genus?

Phylogenetic analysis of the petA gene provides valuable insights into evolutionary relationships within the Illicium genus and its position within the broader angiosperm phylogeny. Based on chloroplast genome analysis of related Illicium species, several important phylogenetic patterns emerge:

Molecular Phylogenetic Methods:
For effective phylogenetic analysis of petA sequences:

  • Extract complete petA coding sequences from chloroplast genomes

  • Perform multiple sequence alignment using MAFFT or similar algorithms

  • Conduct phylogenetic reconstruction using Maximum Likelihood and Bayesian methods

  • Evaluate nodal support through bootstrap analysis and posterior probabilities

  • Root trees using appropriate outgroups from related taxa

Phylogenetic Relationships:

  • Illicium species form a monophyletic group nested within the early-diverging angiosperm clade

  • I. oligandrum shows close relationships with I. parvifolium (it was previously classified as I. parvifolium subsp. oligandrum)

  • Molecular phylogenetic analysis supports the taxonomic placement of Illicium in Schisandraceae or as a separate family Illiciaceae

Evolutionary Implications:

  • The conservation of chloroplast genomes within Illicium suggests relatively recent diversification

  • The petA gene shows utility as a phylogenetic marker due to its appropriate level of sequence variation

  • Comparative analysis of synonymous and non-synonymous substitution rates in petA can reveal selection patterns affecting cytochrome f evolution

The phylogenetic analysis of petA sequences contributes to resolving relationships within this important medicinal plant genus and provides insights into the evolution of photosynthetic systems in early-diverging angiosperms .

How can researchers assess the functional integrity of recombinant Illicium oligandrum Apocytochrome f?

Assessing the functional integrity of recombinant Apocytochrome f requires multiple complementary approaches to verify proper folding, heme incorporation, and electron transfer capability. Recommended methodological approaches include:

Spectroscopic Characterization:

  • UV-visible absorption spectroscopy to confirm heme incorporation (characteristic peaks at ~410 nm and ~550 nm)

  • Circular dichroism (CD) to assess secondary structure elements

  • Fluorescence spectroscopy to evaluate tertiary structure organization

  • Resonance Raman spectroscopy for heme environment characterization

Functional Assays:

  • Electron transfer activity using artificial electron donors and acceptors

  • Reconstitution with purified components of the cytochrome b6f complex

  • Assessment of binding to physiological partners using surface plasmon resonance

Structural Verification:

  • Limited proteolysis to assess proper folding (correctly folded proteins show characteristic digestion patterns)

  • Mass spectrometry to confirm post-translational modifications and protein integrity

  • Size exclusion chromatography to evaluate oligomeric state

In vitro Reconstitution:

  • Assembly with other components of the cytochrome b6f complex

  • Membrane incorporation studies

  • Activity measurements in liposome systems

A comprehensive assessment would integrate multiple techniques to ensure that the recombinant protein accurately represents the native Apocytochrome f structure and function .

What approaches can be used to study the role of specific amino acid residues in Illicium oligandrum Apocytochrome f function?

Understanding the role of specific amino acid residues in Apocytochrome f function requires systematic mutagenesis approaches combined with functional and structural characterization. Several methodological strategies are recommended:

Site-Directed Mutagenesis:

  • Identify conserved residues through sequence alignment of Apocytochrome f from multiple species

  • Design primers for site-directed mutagenesis of selected residues

  • Generate a library of mutants focusing on:

    • Heme-binding motif residues

    • Charged residues potentially involved in protein-protein interactions

    • Conserved residues in transmembrane domains

  • Express and purify mutant proteins using optimized protocols

Functional Characterization of Mutants:

  • Spectroscopic analysis to assess heme incorporation

  • Electron transfer kinetics measurements

  • Binding assays with interaction partners

  • Stability assessments through thermal denaturation

Computational Analysis:

  • Homology modeling of Illicium oligandrum Apocytochrome f structure

  • Molecular dynamics simulations to predict effects of mutations

  • Docking studies with known interaction partners

  • Electrostatic surface potential calculations

Structure-Function Correlation:

  • Correlation of mutation effects with structural context

  • Mapping of functional regions based on mutational analysis

  • Comparison with known structures of cytochrome f from other species

This systematic approach allows researchers to develop a detailed understanding of structure-function relationships in Illicium oligandrum Apocytochrome f and identify residues critical for its role in photosynthetic electron transport .

What are common obstacles in purifying recombinant Illicium oligandrum Apocytochrome f and how can they be addressed?

Purification of recombinant Apocytochrome f presents several challenges due to its membrane association, requirement for proper folding, and need for heme incorporation. Key challenges and solutions include:

Solubility Issues:

  • Challenge: Formation of inclusion bodies during bacterial expression

  • Solutions:

    • Lower expression temperature (16-20°C)

    • Reduce inducer concentration

    • Use solubility-enhancing fusion tags (SUMO, MBP, TrxA)

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Use specialized E. coli strains designed for membrane protein expression

Incomplete Heme Incorporation:

  • Challenge: Obtaining fully heme-loaded cytochrome

  • Solutions:

    • Co-express with cytochrome maturation (Ccm) proteins

    • Supplement growth media with δ-aminolevulinic acid (ALA) to enhance heme biosynthesis

    • Optimize induction timing to align with cellular heme availability

    • Implement in vitro heme reconstitution protocols if necessary

Protein Aggregation During Purification:

  • Challenge: Protein aggregation after cell lysis

  • Solutions:

    • Use appropriate detergents for extraction (e.g., n-dodecyl-β-D-maltoside, CHAPS)

    • Include stabilizing agents in buffers (glycerol, sucrose)

    • Maintain cold temperatures throughout purification

    • Use gradient purification approaches to prevent rapid environmental changes

Proteolytic Degradation:

  • Challenge: Protein degradation during purification

  • Solutions:

    • Include protease inhibitor cocktails in all buffers

    • Reduce purification time with streamlined protocols

    • Perform purification at 4°C

    • Consider removing protease-sensitive regions if they're non-essential for function

Effective purification of functional Apocytochrome f typically requires a multi-step approach combining affinity chromatography, ion exchange, and size exclusion methods, with careful optimization of buffer conditions at each stage .

What storage conditions maintain the stability and activity of purified Illicium oligandrum Apocytochrome f?

Maintaining the stability and activity of purified Apocytochrome f requires careful attention to storage conditions. Based on information for similar proteins and specific details for the recombinant protein, the following recommendations can be made:

Buffer Composition:

  • Tris-based buffer (pH 7.5-8.0) with 50% glycerol provides optimal stability

  • Addition of reducing agents (1-5 mM DTT or 2-mercaptoethanol) prevents oxidative damage

  • Low concentrations of non-ionic detergents (0.01-0.05% n-dodecyl-β-D-maltoside) maintain solubility

  • Salt concentration (100-150 mM NaCl) minimizes aggregation

Temperature Considerations:

  • Short-term storage (1-2 weeks): 4°C with minimal freeze-thaw cycles

  • Medium-term storage (1-3 months): -20°C in buffer containing 50% glycerol

  • Long-term storage (>3 months): -80°C with flash-freezing in liquid nitrogen

  • Repeated freezing and thawing should be avoided; working aliquots should be prepared

Concentration Effects:

  • Protein concentration should be maintained between 0.5-2 mg/ml

  • Higher concentrations risk aggregation

  • Lower concentrations may lead to adsorption to container surfaces

Stability Monitoring:

  • Regular activity assays to confirm functional preservation

  • Spectroscopic analysis to verify heme retention

  • Thermal shift assays to assess conformational stability over time

When properly stored according to these guidelines, purified Apocytochrome f can maintain activity for extended periods, though regular quality control testing is recommended for critical applications .

How can Illicium oligandrum Apocytochrome f be used in photosynthesis research and comparative studies?

Recombinant Illicium oligandrum Apocytochrome f offers valuable opportunities for advancing photosynthesis research through several experimental approaches:

Comparative Cytochrome Function Studies:

  • Reconstitution of hybrid cytochrome b6f complexes incorporating components from different species

  • Assessment of electron transfer rates and efficiency

  • Identification of species-specific adaptations in photosynthetic electron transport

  • Correlation of functional differences with ecological adaptations

Photosynthetic Electron Transport Chain Analysis:

  • In vitro reconstitution of partial or complete electron transport chains

  • Time-resolved spectroscopy to measure electron transfer kinetics

  • Analysis of interaction with plastocyanin and plastoquinone

  • Investigation of regulatory mechanisms affecting electron flow

Structural Biology Applications:

  • Crystallization trials for structural determination

  • Cryo-electron microscopy of reconstituted complexes

  • Contribution to understanding structure-function relationships in cytochrome f

Evolutionary Studies:

  • Comparison of Illicium oligandrum Apocytochrome f with homologs from diverse photosynthetic organisms

  • Investigation of sequence-function relationships across evolutionary distance

  • Reconstruction of ancestral cytochrome sequences to study functional evolution

Biotechnological Applications:

  • Engineering of optimized cytochromes for enhanced photosynthetic efficiency

  • Development of bio-inspired electron transport systems

  • Creation of sensors based on electron transfer properties

These research applications leverage the unique characteristics of Illicium oligandrum Apocytochrome f to advance our understanding of fundamental photosynthetic processes and their evolution .

What emerging technologies can enhance structural and functional studies of Illicium oligandrum Apocytochrome f?

Several cutting-edge technologies are expanding the toolkit available for detailed structural and functional characterization of Apocytochrome f:

Cryo-Electron Microscopy (Cryo-EM):

  • Single-particle analysis for high-resolution structural determination

  • Visualization of Apocytochrome f in its native membrane environment

  • Structural characterization of transient complexes with interaction partners

  • Time-resolved studies capturing different functional states

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Mapping protein dynamics and conformational changes

  • Identification of regions involved in protein-protein interactions

  • Characterization of structural flexibility related to function

  • Assessment of solvent accessibility in different functional states

Advanced Spectroscopic Techniques:

  • Time-resolved fluorescence spectroscopy for dynamic studies

  • Electron paramagnetic resonance (EPR) for characterization of redox centers

  • Two-dimensional infrared spectroscopy for protein dynamics

  • Single-molecule techniques to observe heterogeneity in protein behavior

Computational Methods:

  • Molecular dynamics simulations with enhanced sampling techniques

  • Quantum mechanics/molecular mechanics (QM/MM) for electron transfer studies

  • Machine learning approaches for predicting protein-protein interactions

  • Integrative modeling combining data from multiple experimental sources

Native Mass Spectrometry:

  • Analysis of intact protein complexes

  • Determination of binding stoichiometry

  • Characterization of post-translational modifications

  • Investigation of complex assembly and stability

The integration of these emerging technologies offers unprecedented opportunities to advance our understanding of the structure-function relationships in Illicium oligandrum Apocytochrome f and its role in photosynthetic electron transport .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.