Recombinant Illicium oligandrum ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Illicium oligandrum (Star anise)
Target Names
atpF
Target Protein Sequence
MKNVNDSFVSLGHWPFAGSFGFNTDILATNPINLSVVLGVLIFFGKGVLNDLLDNRKQRI LSTIRNSEELRGGAIEQLEKAWARLRKVEMEADEFRVNGYSEIEREKMNLIIATNENLER LENYKNETIHFEQQRAINQVRQRVFQQALQGALGTLKSCLNSELHLRTISDNIGTLGDMN MKEITD
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase catalyzes ATP synthesis from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembranous) and the F(0) membrane proton channel, connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel and forms part of the peripheral stalk, linking F(1) to F(0).
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is ATP synthase subunit b, chloroplastic (atpF) from Illicium oligandrum?

ATP synthase subunit b, chloroplastic (atpF) from Illicium oligandrum is a critical component of the chloroplast ATP synthase complex responsible for ATP production during photosynthesis. The protein is encoded by the atpF gene in the chloroplast genome and functions as part of the F(0) sector of ATP synthase. According to available information, it is also known as "ATP synthase F(0) sector subunit b" or "ATPase subunit I" and has the UniProt accession number A6MMT0 . This protein plays an essential structural role in forming the peripheral stalk that connects the membrane-embedded F₀ sector with the catalytic F₁ sector, stabilizing the complex during ATP synthesis.

How should recombinant Illicium oligandrum ATP synthase subunit b be stored and handled?

Proper storage and handling of recombinant Illicium oligandrum ATP synthase subunit b is critical for maintaining its structural integrity and function. According to product information, the recommended storage conditions are:

  • Store at -20°C for regular usage

  • For extended storage, maintain at -20°C or -80°C

  • The protein should be kept in Tris-based buffer with 50% glycerol, which has been optimized for stability

  • Working aliquots can be stored at 4°C for up to one week

  • Repeated freezing and thawing should be avoided as it can compromise protein integrity

These storage recommendations reflect the protein's relative stability when properly maintained in glycerol-containing buffer, which helps prevent denaturation and aggregation that might occur during freeze-thaw cycles.

How does Illicium oligandrum atpF relate to other components of the chloroplast ATP synthase complex?

The atpF protein functions as part of an integrated multiprotein complex in chloroplast membranes. In this context:

  • It forms part of the peripheral stalk (stator) of the ATP synthase complex, connecting the F₁ and F₀ domains

  • It interacts with other ATP synthase subunits, including subunit a (atpI), which is also found in Illicium oligandrum chloroplasts

  • The protein works cooperatively with subunit a and the c-ring to form the proton-conducting F₀ sector of ATP synthase

  • Together with other stator components, it helps resist the torque generated during ATP synthesis, maintaining the structural integrity of the complex

This functional integration is critical for the ATP synthesis process, where proton movement through the F₀ sector drives rotation of the central stalk, leading to conformational changes in the F₁ sector that catalyze ATP formation from ADP and phosphate.

What are the optimal expression systems for producing recombinant Illicium oligandrum ATP synthase subunit b?

Based on research with similar ATP synthase subunits, several expression systems can be employed for recombinant production of Illicium oligandrum atpF, each with specific advantages:

  • Bacterial expression systems:

    • E. coli is widely used for ATP synthase subunit expression, with strains like T7 Express lysY/Iq showing good results for similar proteins

    • Vector selection is critical, with pMAL-c2x, pET-32a(+), and pFLAG-MAC all being viable options for expression

    • Co-expression with chaperone proteins (DnaK, DnaJ, and GrpE) significantly enhances expression of membrane proteins like ATP synthase subunits

  • Expression optimization strategies:

    • Codon optimization for the expression host is essential when working with plant chloroplast genes

    • Lower induction temperatures (16-20°C) often improve proper folding

    • Addition of fusion tags like MBP (maltose-binding protein) can enhance solubility

    • The tag type for recombinant Illicium oligandrum atpF is typically determined during the production process to optimize yields

  • Alternative expression systems:

    • Cell-free expression systems may be advantageous for difficult membrane proteins

    • Yeast or insect cell systems could provide better post-translational modifications if needed

When selecting an expression system, researchers should consider downstream applications, required protein yield, and whether native folding is essential for functional studies.

How can the functionality of recombinant Illicium oligandrum ATP synthase subunit b be assessed in vitro?

Assessing functionality of recombinant atpF requires multiple approaches since it primarily serves structural roles in the ATP synthase complex:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to verify secondary structure

    • Limited proteolysis to identify properly folded, protease-resistant domains

    • Size-exclusion chromatography coupled with multi-angle light scattering to assess oligomeric state

  • Protein-protein interaction assays:

    • Pull-down assays using tagged recombinant atpF

    • Surface plasmon resonance to measure binding kinetics with other ATP synthase subunits

    • Crosslinking studies to capture interactions within reconstituted complexes

  • Functional reconstitution:

    • Integration into liposomes to verify membrane association

    • Assembly with other ATP synthase subunits to form partial or complete complexes

    • Adaptation of fluorescence-based methods using Magnesium Green to measure ADP/ATP exchange in reconstituted systems

    • Comparative analysis with radioactivity-based exchange assays as described for similar ATP synthase components

A comprehensive assessment would combine these approaches, starting with verification of structural integrity before proceeding to more complex functional reconstitution experiments.

How does the evolutionary conservation of atpF in Illicium oligandrum compare to other plants?

Evolutionary analysis of Illicium oligandrum atpF provides important insights about functional constraints and adaptation:

  • Genomic context:

    • The atpF gene in Illicium oligandrum is located in the Large Single Copy (LSC) region of the chloroplast genome, consistent with most flowering plants

    • The Illicium oligandrum chloroplast genome (148,553 bp) differs slightly in size from related species in the Schisandraceae family like Kadsura coccinea (145,413 bp) and Schisandra chinensis (147,772 bp)

  • Sequence element distribution:

    • Illicium oligandrum contains significantly more Simple Sequence Repeats (SSRs) (100) compared to related species Kadsura coccinea (43) and Schisandra chinensis (74)

    • The majority of these SSRs (74%) are located in the LSC region where atpF resides

    • The distribution pattern of different repeat types (forward, palindromic, and tandem) differs between Illicium oligandrum and related species, with Illicium showing fewer forward repeats (8) but more palindromic (21) and tandem repeats (32)

  • Chloroplast genome comparison:

    FeatureIllicium oligandrumKadsura coccineaSchisandra chinensis
    Total genome (bp)148,553145,413147,772
    LSC region (bp)98,05794,30197,351
    IR region (bp)15,11416,53615,058
    SSC region (bp)20,26718,04020,305
    GC content (%)39.139.739.5
    Total SSRs1004374
    Forward repeats81730
    Palindrome repeats211613
    Tandem repeats322525

These genomic features may influence atpF expression patterns and regulation in Illicium oligandrum compared to other species, potentially reflecting adaptations to different environmental conditions or metabolic requirements .

What techniques can be used to study interactions between ATP synthase subunit b and other components of the ATP synthase complex?

Multiple complementary techniques can characterize interactions between atpF and other ATP synthase components:

  • Biochemical approaches:

    • Co-immunoprecipitation using antibodies against atpF or potential binding partners

    • Pull-down assays with tagged recombinant proteins

    • Chemical cross-linking followed by mass spectrometry to map interaction interfaces

    • Blue Native PAGE to analyze intact complexes and subcomplexes

  • Biophysical methods:

    • Surface plasmon resonance for real-time interaction measurements

    • Isothermal titration calorimetry to determine thermodynamic binding parameters

    • Förster resonance energy transfer (FRET) to detect proximity between labeled components

    • Hydrogen-deuterium exchange mass spectrometry to identify interaction regions

  • Structural biology techniques:

    • X-ray crystallography of reconstituted subcomplexes

    • Cryo-electron microscopy of assembled ATP synthase complexes

    • Molecular dynamics simulations to model dynamic interactions

  • Functional reconstitution:

    • Proteoliposome-based assays similar to those described for adenine nucleotide translocase (ANT)

    • Adaptation of fluorescence-based ADP/ATP exchange measurements to assess functional impacts of specific interactions

    • Radioactivity-based exchange methods as complementary approaches to fluorescence techniques

Integrating data from multiple techniques provides the most comprehensive understanding of protein-protein interactions within this complex system.

What are the methodological challenges in reconstituting functional ATP synthase complexes using recombinant subunits?

Reconstituting functional ATP synthase complexes from recombinant subunits presents several methodological challenges:

  • Expression and purification challenges:

    • Membrane proteins like ATP synthase subunits often express poorly in heterologous systems

    • Co-expression with chaperone proteins (DnaK, DnaJ, and GrpE) can significantly improve yields, as demonstrated with other ATP synthase subunits

    • Different subunits may require different expression systems or conditions for optimal production

    • Maintaining protein stability during purification requires careful optimization of detergents and buffer conditions

  • Assembly challenges:

    • Correct stoichiometry of subunits is critical for functional complex formation

    • Some subunits may require specific assembly factors not present in in vitro systems

    • The c-subunit ring has variable stoichiometry across species, affecting the proton:ATP ratio

  • Functional assessment limitations:

    • Established protocols using both fluorescence-based and radioactivity-based methods are available for measuring transport activities

    • Distinguishing between ATP/ADP exchange due to specific ATP synthase activity versus other transport processes requires appropriate controls

    • Size-exclusion chromatography can be used to separate external substrates from proteoliposomes before measuring exchange activities

  • Technical approaches to overcome challenges:

    • Sequential reconstitution starting with well-characterized subcomplexes

    • Liposome preparation techniques that ensure proper protein orientation

    • Combining fluorescence assays with radioactively labeled substrates for validation

    • Use of specific inhibitors to confirm the identity of the measured activities

How can site-directed mutagenesis of Illicium oligandrum atpF advance our understanding of structure-function relationships?

Site-directed mutagenesis of recombinant Illicium oligandrum atpF represents a powerful approach to understanding structure-function relationships:

  • Target selection strategies:

    • Focus on conserved residues identified through evolutionary analysis

    • Target specific domains: membrane-spanning segments versus peripheral regions

    • Interface residues that mediate interactions with other ATP synthase subunits

    • Regions with unique features in Illicium oligandrum compared to other species

  • Experimental approaches:

    • PCR-based mutagenesis of the cloned atpF gene in expression vectors similar to those used for other ATP synthase subunits

    • Expression and purification using optimized protocols for the wild-type protein

    • Comparative analysis of mutant vs. wild-type protein properties

    • Reconstitution experiments to assess functional impacts

  • Functional assays:

    • Structural integrity using biophysical techniques

    • Membrane association properties in liposome systems

    • Protein-protein interactions with other ATP synthase components

    • ATP synthesis/hydrolysis activities in reconstituted systems using fluorescence-based or radioactivity-based methods

  • Interpretation framework:

    • Correlation of mutational effects with structural models

    • Comparison with equivalent mutations in other species

    • Integration with existing knowledge about ATP synthase mechanisms

    • Development of refined models of ATP synthase function

This approach can reveal critical residues involved in specific functions, providing insights into the mechanical coupling between proton translocation and ATP synthesis in the chloroplast ATP synthase complex.

What are the latest methodological advances for measuring ATP synthase activity in reconstituted systems?

Recent methodological advances have expanded researchers' toolkit for measuring ATP synthase activity:

  • Fluorescence-based methods:

    • Magnesium Green (MgGr) fluorescence assays provide a non-radioactive alternative for measuring ADP/ATP exchange

    • These methods can be adapted for high-throughput screening applications

    • The technique relies on the different binding affinities of Mg²⁺ for ATP versus ADP, resulting in fluorescence changes during exchange

    • Comparative analysis shows these methods provide results comparable to traditional radioactivity-based approaches

  • Protocol optimization:

    • For proteoliposome preparations, size-exclusion chromatography effectively removes external substrates before measurements

    • Proper control experiments must account for non-specific binding and background signal

    • Specific inhibitors can be used to confirm that measured activities are attributable to the target protein

  • Complementary approaches:

    • Radioactivity-based measurements using ³H-labeled ATP remain valuable for validation

    • Size-exclusion chromatography followed by liquid scintillation counting allows quantitative determination of exchange rates

    • Combined fluorescence and radioactivity methods provide more robust results

  • Data analysis considerations:

    • Fitting transport kinetics to appropriate mathematical models

    • Statistical analysis should include at least three independent measurements to ensure reproducibility

    • Display of results as mean ± standard deviation allows proper evaluation of data quality

These methodological advances provide researchers with a more comprehensive toolkit for investigating ATP synthase function, with particular utility for studies involving recombinant subunits like Illicium oligandrum atpF.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.