Recombinant Illicium oligandrum Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Illicium oligandrum (Star anise)
Target Names
cemA
Target Protein Sequence
MPKRKALTPFPYLASIVFLPWGISLSFNKSLESWVINWWNTRQSETFLNDIQEKKVLERF IELEELFLLDEMIKEYSGTHIQKLRIGIYKETIQLVRMHNQDHIHLILHFSTNIICFTIL SAYSILGNEELVILNSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGLVYQN FGFAHNEQVISGLVSTFPVIIDTILKYWIFLFLNRVSPSLVVIYHSMNE
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly facilitates efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the chloroplast envelope membrane protein (cemA) in Illicium oligandrum?

The chloroplast envelope membrane protein (cemA) in Illicium oligandrum is a functional protein encoded by the chloroplast genome. It is specifically located in the chloroplast envelope membrane and plays a role in chloroplast function. According to available protein data, the cemA protein in Illicium oligandrum has a Uniprot identifier of A6MMV6 and consists of 229 amino acids . While its specific function has not been fully characterized in Illicium oligandrum, chloroplast envelope membrane proteins generally contribute to processes such as ion transport, protein import, and maintaining chloroplast integrity. The cemA gene is part of the conserved gene content found in the chloroplast genomes of basal angiosperms, including the related Schisandraceae family members such as Schisandra sphenanthera and Schisandra chinensis .

How does the chloroplast genome of Illicium oligandrum compare to other basal angiosperms?

The chloroplast genome of Illicium oligandrum shows distinct features when compared to other basal angiosperms. Comparative analysis reveals the following characteristics:

SpeciesTotal Length (bp)LSC Region (bp)SSC Region (bp)IR Region (bp)
Schisandra sphenanthera146,85395,62718,29216,467
Schisandra chinensis146,73097,35120,30515,058
Illicium oligandrum148,55397,14420,26715,571
Amborella trichopoda162,68690,97018,41426,651
Nymphaea alba159,93090,01419,56225,177
Trithuria inconspicua165,38984,4686,35437,284
Average155,02492,59617,19922,702

What are the optimal conditions for storing and handling recombinant Illicium oligandrum cemA protein?

For optimal integrity and activity of recombinant Illicium oligandrum cemA protein, the following storage and handling conditions should be implemented:

  • Short-term storage: Store working aliquots at 4°C for up to one week.

  • Long-term storage: Store at -20°C, or for extended preservation, conserve at -20°C or -80°C.

  • Buffer composition: The protein should be maintained in a Tris-based buffer with 50% glycerol, optimized specifically for this protein.

  • Avoid freeze-thaw cycles: Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity.

  • Aliquoting strategy: Upon receipt, the protein should be divided into small working aliquots to minimize freeze-thaw cycles.

These conditions ensure the structural and functional integrity of the protein during experimental procedures . For experiments requiring extended use of the protein, it's advisable to prepare fresh dilutions from frozen stocks rather than repeatedly freezing and thawing the same sample. Additionally, researchers should verify protein stability using appropriate analytical methods (such as SDS-PAGE or activity assays) after extended storage periods to ensure experimental reproducibility.

What methods are most effective for comparing cemA sequences across different plant species?

When comparing cemA sequences across different plant species, a multi-faceted approach incorporating several complementary methods yields the most comprehensive results:

  • Multiple Sequence Alignment (MSA): Utilize software packages such as MAFFT, MUSCLE, or ClustalW to align cemA sequences from various species, allowing identification of conserved and variable regions.

  • Sliding Window Analysis: Implement sliding window analysis to identify regions of high variability. For example, the analysis of chloroplast genomes between Schisandra sphenanthera and Schisandra chinensis revealed nucleotide variability (Pi) values ranging from 0 to 0.03000 with a mean of 0.00364 . This approach could be applied specifically to cemA sequences.

  • Phylogenetic Analysis: Construct phylogenetic trees using maximum likelihood, Bayesian inference, or neighbor-joining methods to visualize evolutionary relationships between cemA sequences across species.

  • SNP and InDel Identification: Use specialized software like DnaSP to identify single nucleotide polymorphisms (SNPs) and insertion/deletion mutations (InDels) between cemA sequences, as was done for the chloroplast genomes of S. sphenanthera and S. chinensis, revealing 474 SNPs and 97 InDels .

  • Codon Usage Analysis: Analyze codon usage patterns to identify potential selection pressures on the cemA gene across different lineages.

  • Structural Prediction: Use protein structure prediction tools to compare potential structural differences resulting from sequence variations.

This integrated approach provides insights into both sequence conservation and functional implications of cemA evolution across plant species, particularly within basal angiosperms.

How can researchers verify the functional integrity of recombinant cemA protein?

Verifying the functional integrity of recombinant cemA protein requires a multi-tiered experimental approach:

  • Structural Integrity Assessment:

    • SDS-PAGE analysis to confirm appropriate molecular weight (expected ~25 kDa based on the 229 amino acid sequence) .

    • Circular Dichroism (CD) spectroscopy to evaluate secondary structure elements.

    • Limited proteolysis to assess proper protein folding.

  • Membrane Association Analysis:

    • Membrane fractionation studies to confirm localization to membrane compartments.

    • Liposome binding assays to verify interaction with lipid bilayers.

    • Detergent solubility profiling to characterize membrane integration properties.

  • Functional Assays:

    • Ion transport measurements using reconstituted proteoliposomes.

    • Fluorescence-based assays to monitor potential pH gradient formation across membranes.

    • Binding studies with potential interaction partners from the chloroplast envelope.

  • Comparative Analysis:

    • Side-by-side functional comparison with cemA proteins from related species like Schisandra to identify conserved functional properties.

    • Complementation studies in cemA-deficient systems to assess functional equivalence.

  • Post-translational Modification Assessment:

    • Mass spectrometry to identify any post-translational modifications essential for function.

    • Phosphorylation state analysis using phospho-specific antibodies or Phos-tag gels.

When designing these verification experiments, it's crucial to include appropriate controls, such as heat-denatured protein samples, unrelated membrane proteins of similar size, and cemA proteins with site-directed mutations in presumed functional domains.

What is the significance of IR expansion/contraction in the Illicium oligandrum chloroplast genome?

The Inverted Repeat (IR) expansion/contraction in the Illicium oligandrum chloroplast genome represents a significant evolutionary feature with several important implications:

Understanding these IR dynamics provides insights into the evolutionary history of Illicium oligandrum and its relationship to other basal angiosperms, potentially including how the cemA gene has evolved in this lineage.

What genomic hotspot regions could be used alongside cemA for phylogenetic studies in Illicium and related genera?

Several genomic hotspot regions with high variability can complement cemA for comprehensive phylogenetic studies in Illicium and related genera:

  • High-Variability Intergenic Regions: Based on comparative analysis between Schisandra sphenanthera and Schisandra chinensis, five regions with notably higher variation (Pi > 0.015) have been identified: trnS-trnG, ccsA-ndhD, psbI-trnS, trnT-psbD, and ndhF-rpl32 . These regions, predominantly located in the LSC and SSC regions rather than the more conserved IR regions, likely also exhibit high variability in Illicium species.

  • IR/SC Boundary Regions: The junction regions between inverted repeats and single-copy regions show significant variation across basal angiosperms. In Illicium oligandrum, the IRB region expands into ycf1 by 413 bp, compared to 1283 bp in S. sphenanthera and 1281 bp in S. chinensis . These boundary shifts can serve as informative markers for phylogenetic analysis.

  • SNP and InDel Hotspots: Systematic identification of SNPs and InDels throughout the chloroplast genome, as performed for S. sphenanthera and S. chinensis (revealing 474 SNPs and 97 InDels), can highlight additional variable regions suitable for phylogenetic studies .

  • Non-Coding Regions: Generally, non-coding regions exhibit higher divergence than coding regions across basal angiosperms. Focusing on intergenic spacers and introns, particularly within the SSC region, can provide additional phylogenetic signals.

  • Nuclear Markers to Complement Chloroplast Data: For comprehensive phylogenetic studies, researchers should consider combining chloroplast markers with nuclear markers, such as ITS regions or single-copy nuclear genes, to capture both maternal and biparental inheritance patterns.

When designing phylogenetic studies for Illicium and related genera, researchers should employ a multi-locus approach incorporating several of these highly variable regions alongside cemA to resolve relationships at different taxonomic levels. This approach would be particularly valuable for addressing questions about species boundaries, hybridization, and evolutionary relationships within the Schisandraceae family.

How does the structure and arrangement of genes near cemA in Illicium oligandrum compare with other angiosperms?

The structure and arrangement of genes near the cemA locus in Illicium oligandrum reveals important evolutionary patterns when compared with other angiosperms:

  • Conserved Gene Order in Basal Angiosperms: While the search results don't specifically mention the genes flanking cemA in Illicium oligandrum, chloroplast gene order tends to be relatively conserved among related species. Based on comparative genomic analyses, Illicium oligandrum shares more similarities in gene arrangement with other basal angiosperms like Schisandra species than with more derived angiosperms .

  • IR/SC Boundary Influences: The position of cemA relative to the IR/SC boundaries can vary among species. In many angiosperms, cemA is typically located in the LSC region. The contracted IR regions in Illicium oligandrum (15,571 bp) compared to other basal angiosperms like Amborella trichopoda (26,651 bp) and Trithuria inconspicua (37,284 bp) suggest potential differences in gene arrangements near IR/SC boundaries, which could affect genes in proximity to cemA .

  • Gene Cluster Conservation: In most angiosperms, cemA is part of a conserved gene cluster in the LSC region. Comparative analysis of the chloroplast genomes of six basal angiosperms showed that the variation pattern in the length of SC regions was consistent with that of IR regions among all species analyzed except Illicium oligandrum , suggesting possible unique arrangements in Illicium.

  • Implications for Gene Expression: The arrangement of genes near cemA can influence gene expression through shared regulatory elements or polycistronic transcription. Any variations in gene order specific to Illicium oligandrum would potentially affect the coordinated expression of cemA with neighboring genes.

  • Evolutionary Significance: Unique gene arrangements around cemA could provide insights into chloroplast genome evolution in the Schisandraceae family and other basal angiosperms. These arrangements may reflect ancient genomic rearrangements or independent evolutionary events in the Illicium lineage.

A detailed synteny analysis comparing the cemA region across multiple angiosperm species would further illuminate the evolutionary dynamics of this region and potentially identify Illicium-specific features that could serve as taxonomic markers.

How might site-directed mutagenesis of conserved regions in cemA inform our understanding of its function?

Site-directed mutagenesis of conserved regions in cemA presents a powerful approach for elucidating the protein's function through the following methodological framework:

  • Identification of Target Residues: Analysis of the 229-amino acid sequence of Illicium oligandrum cemA should focus on:

    • Highly conserved residues across multiple species

    • Predicted functional domains (membrane-spanning regions, potential binding sites)

    • Charged residues that might participate in ion transport

    • Putative post-translational modification sites

  • Systematic Mutagenesis Strategy:

    • Alanine scanning: Replace conserved residues systematically with alanine to identify essential amino acids

    • Conservative substitutions: Replace residues with chemically similar amino acids to assess the importance of specific chemical properties

    • Non-conservative substitutions: Introduce drastically different amino acids at key positions to disrupt potential functional domains

    • Domain swapping: Exchange putative functional domains with corresponding regions from distantly related species

  • Expression System Selection:

    • Heterologous expression in E. coli using specialized vectors for membrane proteins

    • Plant-based expression systems (e.g., tobacco chloroplast transformation) for more native conditions

    • Cell-free expression systems to avoid toxicity issues that might arise with membrane protein overexpression

  • Functional Assays for Mutant Proteins:

    • Membrane integration analysis using protease protection assays

    • Liposome reconstitution to assess ion transport capabilities

    • Protein-protein interaction studies to identify altered binding affinities

    • In vivo complementation tests in model organisms with cemA deletions

  • Structural Analysis:

    • Circular dichroism spectroscopy to assess changes in secondary structure

    • Limited proteolysis to examine conformational changes

    • If feasible, X-ray crystallography or cryo-EM analysis of wild-type and select mutants

This comprehensive mutagenesis approach would provide insights into which regions of cemA are critical for proper folding, membrane integration, and function. Particular attention should be paid to the highly hydrophobic regions that likely span the membrane and charged residues that might participate in ion movement or protein-protein interactions. The results would significantly advance our understanding of cemA's role in chloroplast membrane processes.

What are the potential applications of recombinant cemA protein in studying chloroplast evolution in basal angiosperms?

Recombinant cemA protein offers several innovative applications for studying chloroplast evolution in basal angiosperms:

  • Structural Basis for Evolutionary Adaptation:

    • Comparative structural analysis of recombinant cemA proteins from diverse basal angiosperms (including Illicium oligandrum, Schisandra species, Amborella trichopoda) can reveal how structural features have evolved in response to different environmental pressures.

    • Biophysical characterization methods like circular dichroism, fluorescence spectroscopy, and potentially X-ray crystallography could identify structural differences that correlate with species-specific adaptations.

  • Functional Evolution Assessment:

    • Recombinant cemA proteins from different species can be reconstituted into liposomes to compare their functional properties, including potential ion transport capabilities or membrane organization functions.

    • Cross-species complementation experiments could determine whether cemA proteins from different basal angiosperms are functionally interchangeable, suggesting conservation of function, or exhibit species-specific properties.

  • Interaction Partner Identification:

    • Protein-protein interaction studies using techniques like co-immunoprecipitation, yeast two-hybrid, or cross-linking mass spectrometry with recombinant cemA can identify interaction partners.

    • Comparing interaction networks across basal angiosperm species could reveal how protein-protein interactions involving cemA have evolved.

  • Antibody Development for Evolutionary Studies:

    • Antibodies raised against recombinant Illicium oligandrum cemA can be used for immunolocalization studies across diverse species.

    • Western blot analysis using these antibodies could track cemA protein expression levels across different species and growth conditions.

  • In vitro Evolution Experiments:

    • Directed evolution of recombinant cemA in laboratory conditions mimicking different environmental stresses could provide insights into adaptive mechanisms.

    • The results could be compared with natural sequence variations observed in different basal angiosperm species.

These approaches collectively contribute to understanding how cemA has evolved within basal angiosperms and potentially adapted to different ecological niches. The availability of recombinant cemA provides a valuable tool for these evolutionary studies, allowing researchers to move beyond sequence-based analyses to functional and structural investigations.

How can researchers integrate cemA data with other molecular markers for comprehensive phylogenetic analysis of the Illicium genus?

Integrating cemA data with other molecular markers for comprehensive phylogenetic analysis of the Illicium genus requires a methodologically sound multi-marker approach:

  • Strategic Marker Selection:

    • Chloroplast Markers: Combine cemA with the five highly variable regions identified in comparative studies (trnS-trnG, ccsA-ndhD, psbI-trnS, trnT-psbD, and ndhF-rpl32) to provide a comprehensive chloroplast perspective.

    • Nuclear Markers: Include ITS (Internal Transcribed Spacer) regions and single-copy nuclear genes to capture biparental inheritance patterns.

    • Mitochondrial Markers: Select conserved mitochondrial genes to incorporate a third genomic compartment.

  • Sampling Strategy:

    • Ensure comprehensive taxonomic sampling within Illicium (at least 70% of recognized species).

    • Include multiple accessions per species to assess intraspecific variation.

    • Sample across the geographical range of each species to capture genetic diversity.

    • Include appropriate outgroups from related genera in Schisandraceae and other basal angiosperm families.

  • Data Generation Protocols:

    • Standardize DNA extraction protocols to ensure comparable DNA quality across samples.

    • Design universal primers for cemA amplification across Illicium species based on the known sequence from Illicium oligandrum .

    • Use next-generation sequencing approaches for more comprehensive data generation.

  • Analytical Framework:

    • Individual Gene Trees: Construct separate phylogenetic trees for each marker using maximum likelihood and Bayesian inference methods.

    • Concatenated Analysis: Combine all markers into a supermatrix for comprehensive phylogenetic reconstruction.

    • Species Tree Methods: Implement coalescent-based species tree methods (like ASTRAL or *BEAST) to account for gene tree incongruence.

    • Network Analysis: Apply phylogenetic network methods to visualize potential reticulation events.

  • Comparative Analysis with Morphological Data:

    • Integrate molecular phylogenies with morphological character matrices.

    • Map bioactive compounds (like those identified in Illicium oligandrum such as illioliganones A, B, and C) onto the phylogeny to identify evolutionary patterns in chemical profiles.

  • Dating and Biogeographic Analysis:

    • Calibrate the molecular phylogeny using fossil evidence.

    • Reconstruct ancestral ranges to understand biogeographic patterns within Illicium.

This integrated approach leverages the strengths of multiple markers, including cemA, while accounting for the different evolutionary histories that may be captured by chloroplast, nuclear, and mitochondrial genomes. The resulting comprehensive phylogenetic framework would provide insights into species relationships, hybridization events, and evolutionary patterns within Illicium, with applications for both systematic botany and traditional medicine research.

What experimental approaches could elucidate the specific role of cemA in chloroplast function in Illicium oligandrum?

To elucidate the specific role of cemA in chloroplast function in Illicium oligandrum, researchers should implement a multi-faceted experimental strategy:

  • Gene Silencing and Knockout Approaches:

    • CRISPR/Cas9 Editing: While challenging in non-model plants like Illicium, CRISPR-based approaches could be adapted for chloroplast genome editing to create cemA knockouts.

    • Virus-Induced Gene Silencing (VIGS): Develop VIGS vectors targeting cemA to achieve transient knockdown.

    • Heterologous Complementation: Test whether Illicium oligandrum cemA can complement cemA mutants in model plant systems like Arabidopsis or tobacco.

  • Protein Localization and Interaction Studies:

    • Immunogold Electron Microscopy: Using antibodies against the recombinant cemA protein , precisely localize the protein within chloroplast membranes.

    • Split-GFP Assays: Identify interaction partners through in vivo split-GFP complementation assays.

    • Co-Immunoprecipitation Followed by Mass Spectrometry: Identify the complete interactome of cemA in chloroplast membranes.

    • Blue Native PAGE: Determine if cemA participates in specific protein complexes within the chloroplast membrane.

  • Functional Characterization:

    • Electrophysiological Studies: Reconstitute purified recombinant cemA into artificial membranes for patch-clamp analysis to test potential ion transport activity.

    • Chloroplast Isolation and Functional Assays: Compare chloroplast function (photosynthetic efficiency, ion homeostasis) between wild-type and cemA-silenced plants.

    • Metabolomic Analysis: Assess changes in chloroplast-associated metabolites when cemA expression is altered.

    • Chlorophyll Fluorescence Measurements: Determine if cemA affects photosystem efficiency through detailed fluorescence analysis.

  • Structural Studies:

    • Cryogenic Electron Microscopy (cryo-EM): Attempt structural determination of cemA within native membrane environment.

    • Hydrogen-Deuterium Exchange Mass Spectrometry: Map the membrane topology and dynamics of cemA.

    • Cross-linking Mass Spectrometry: Identify points of interaction with other chloroplast proteins.

  • Comparative Transcriptomics and Proteomics:

    • RNA-Seq Analysis: Compare transcriptional profiles between wild-type and cemA-silenced plants to identify affected pathways.

    • Differential Proteomics: Identify proteins with altered abundance or post-translational modifications in response to cemA manipulation.

    • Ribosome Profiling: Determine if cemA affects translation of chloroplast-encoded genes.

By implementing this comprehensive strategy, researchers would gain insights into the specific molecular function of cemA in chloroplast processes, potentially revealing its role in ion homeostasis, membrane organization, or protein complex assembly in the unique context of Illicium oligandrum chloroplast biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.