Recombinant Illicium oligandrum Cytochrome c biogenesis protein ccsA (ccsA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cytochrome c Biogenesis

The ccsA protein facilitates heme ligation to apocytochrome c in chloroplasts, a process critical for electron transport chains . Comparative chloroplast genome analyses reveal its conserved presence across basal angiosperms, including Schisandra and Illicium species .

Key Functional Domains:

  • Transmembrane Regions: Critical for thylakoid membrane localization .

  • Heme-Binding Motifs: Identified through sequence alignment with bacterial homologs .

Expression and Purification Protocols

Recombinant ccsA is produced using standardized protocols:

Production Workflow:

  1. Vector Construction: Full-length ccsA gene cloned into E. coli expression vectors .

  2. Induction: IPTG-induced expression in BL21(DE3) strains .

  3. Purification: Nickel-affinity chromatography leveraging the His-tag .

Research Applications

This recombinant protein is utilized in:

  • Cytochrome c Assembly Studies: Investigating heme attachment mechanisms .

  • Phylogenetic Analyses: Serving as a marker for chloroplast genome evolution in basal angiosperms .

  • Enzyme Engineering: Optimizing prokaryotic cytochrome c biogenesis pathways .

Comparative Genomic Insights

The ccsA gene is highly conserved in chloroplast genomes of Illicium species, with notable features:

Chloroplast Genome Comparisons:

SpeciesGenome Size (bp)ccsA PositionGC Content (%)
Illicium oligandrum146,853LSC region39.6
Schisandra sphenanthera146,730LSC region39.7
Illicium verum142,689LSC region39.8

Data derived from

Future Directions

Ongoing research aims to:

  • Resolve the crystal structure of ccsA to elucidate heme-binding mechanisms.

  • Engineer thermostable variants for industrial biocatalysis .

  • Explore its role in stress responses in Illicium species .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to settle the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ccsA; Cytochrome c biogenesis protein CcsA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Illicium oligandrum (Star anise)
Target Names
ccsA
Target Protein Sequence
MIFVILEHILTHISFSIIAIVITTHLMTLLVHEIVGLCDSSEKGMIATFFCITGLLVTRW IYSGHFPLNDLYESLMFLSWSFSLILMVPYFKNHKNHFSTITAPSAICTQSFATSGLSTE IHQSEILVPALQSHWLMMHVSMMLLSYAALLCGSLLSIALLVITFRKNIDMIGFTNHLLI WPFSFGEIKYLNEKRSLLKNTSFLLFRNYHRYQLTQRLDHWSYRVIGLGFTFSTIGILSG AVWANEAWGSYWNWDPKETWAFITWTISAIYSHTRTNKSLQGMNSAIVASMGFLIIWICY FGVNLLGIGLHSYGSFT
Uniprot No.

Target Background

Function
Plays a critical role in the biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f), specifically during the heme attachment step.
Protein Families
CcmF/CycK/Ccl1/NrfE/CcsA family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the ccsA protein and what is its role in cytochrome c biogenesis?

The ccsA protein is a membrane-bound component of the cytochrome c biogenesis System II that plays a crucial role in the maturation of c-type cytochromes. In this system, ccsA (also known as ResC in some organisms) functions as part of the cytochrome c synthase complex alongside CcsB (ResB) . The process of cytochrome c biogenesis involves several key steps: the periplasmic reduction of cysteine residues in the heme c attachment motif of the apocytochrome, transmembrane transport of heme b, and stereospecific covalent heme attachment via thioether bonds .

Within this process, ccsA specifically participates in the heme attachment step, contributing to the formation of thioether bonds between the heme vinyl groups and the cysteine thiols of the apocytochrome. This protein is essential for proper cytochrome c maturation, which in turn affects electron transport chains in respiration and photosynthesis. In chloroplast genomes, including that of Illicium oligandrum, ccsA is classified as a c-type cytochrome synthesis gene .

How is the genomic organization of ccsA conserved across basal angiosperms?

Comparative analysis of chloroplast genomes across basal angiosperms, including Illicium oligandrum and related species, reveals interesting patterns of conservation and divergence. The ccsA gene is maintained as part of the core chloroplast genome in all examined species, underscoring its essential function . In the chloroplast genomes of Schisandra sphenanthera, Schisandra chinensis, Illicium oligandrum, and other basal angiosperms, ccsA is classified among the functional genes for photosynthesis .

When examining the comparative genomic structure, the chloroplast genome of Illicium oligandrum (148,553 bp) is relatively similar in size to those of Schisandra sphenanthera (146,853 bp) and Schisandra chinensis (146,730 bp), though somewhat smaller than other basal angiosperms like Amborella trichopoda (162,686 bp) and Trithuria inconspicua (165,389 bp) . The genomic context and organization around ccsA appear to be relatively conserved, though specific boundary dynamics between the inverted repeat (IR) regions and the small single copy (SSC) regions—where ccsA is typically located—can vary between species.

What structural features distinguish ccsA within System II cytochrome c biogenesis?

The ccsA protein functions as part of System II (or Ccs system) of cytochrome c biogenesis, which is found in β-, δ- and ε-proteobacteria, Gram-positive bacteria, Aquificales, cyanobacteria, and importantly, in algal and plant chloroplasts . While the search results don't provide detailed structural information specific to Illicium oligandrum ccsA, research on System II components indicates that ccsA is a membrane-spanning protein with multiple transmembrane domains.

CcsA partners with CcsB to form the core cytochrome c synthase complex responsible for heme attachment. In some organisms, particularly certain ε-proteobacteria, CcsA and CcsB exist as a fusion protein (CcsBA), forming a single polypeptide cytochrome c synthase that has proven useful for functional studies . This suggests that the spatial relationship and interaction between these proteins are critical for function, with the two components working in concert to facilitate heme transport and attachment.

How does the function of ccsA relate to chloroplast genome evolution?

The expansion and contraction of inverted repeat (IR) regions contribute significantly to chloroplast genome size variation across species. While the search results don't specifically address the position of ccsA relative to these IR boundaries in Illicium oligandrum, such positional dynamics can affect gene evolution rates. Genes located within IR regions typically exhibit slower rates of sequence evolution due to copy correction mechanisms, whereas those in single copy regions may evolve more rapidly . Understanding ccsA's genomic context provides insights into evolutionary constraints on this critical biogenesis factor.

Interestingly, the comparative analysis also shows that while some genes like ycf15 may be lost in certain lineages, functionally essential genes like ccsA are maintained across diverse plant groups . This pattern of conservation amid genomic flux underscores ccsA's critical role in cytochrome c biogenesis and, consequently, in photosynthetic and respiratory electron transport.

What protein-protein interactions are critical for ccsA function in System II?

The functional efficiency of ccsA depends on complex protein-protein interactions within the System II cytochrome c biogenesis pathway. Most critically, ccsA (ResC) interacts directly with CcsB (ResB) to form the cytochrome c synthase complex essential for heme attachment . This interaction creates a functional unit capable of transporting heme across the membrane and facilitating its attachment to the apocytochrome.

Additionally, the complete System II involves interactions with other components, particularly CcdA and CcsX (ResA), which function in generating the reduced heme c attachment motif . These proteins work together to ensure proper cysteine reduction in the apocytochrome heme binding motif (typically CXXCH), preparing it for subsequent heme attachment by the CcsA-CcsB complex.

Research investigating these protein-protein interactions often employs techniques such as co-immunoprecipitation, yeast two-hybrid assays, or more advanced approaches like bimolecular fluorescence complementation (BiFC) in plant systems. For recombinant expression studies, understanding these interaction networks is critical for designing constructs that maintain functional protein-protein interfaces.

How do mutations in conserved domains of ccsA affect cytochrome c maturation?

While the search results don't provide specific information about mutations in Illicium oligandrum ccsA, research on System II components indicates that ccsA contains several conserved domains critical for function. These include transmembrane domains that anchor the protein in the membrane, heme-binding motifs that facilitate heme transport, and interaction domains that mediate assembly with CcsB.

Mutations in these conserved domains can disrupt cytochrome c maturation through several mechanisms:

  • Heme binding and transport: Mutations in residues involved in heme coordination can prevent proper binding and translocation of heme across the membrane.

  • CcsB interaction: Alterations to residues at the CcsA-CcsB interface can destabilize the cytochrome c synthase complex.

  • Membrane integration: Mutations affecting transmembrane domains can disrupt proper insertion or orientation of ccsA in the membrane.

  • Substrate recognition: Changes to regions involved in apocytochrome recognition can impair the ability of the synthase complex to identify and process its substrate.

Experimental approaches to studying such mutations include site-directed mutagenesis followed by functional complementation assays, in vitro reconstitution of cytochrome c synthesis, and spectroscopic analysis of cytochrome c production.

What expression systems are optimal for producing recombinant Illicium oligandrum ccsA?

Producing recombinant membrane proteins like ccsA presents significant challenges due to their hydrophobic nature and complex folding requirements. For Illicium oligandrum ccsA, several expression systems could be considered, each with distinct advantages:

The choice of expression system should be guided by the intended application. For structural studies requiring high protein yields, bacterial or yeast systems might be preferred despite potential folding issues. For functional studies where proper folding is paramount, plant-based systems may be more appropriate despite lower yields.

What purification strategies yield functional recombinant ccsA protein?

Purification of membrane proteins like ccsA requires specialized approaches to maintain structure and function throughout the process. A comprehensive purification strategy for recombinant Illicium oligandrum ccsA might include:

  • Membrane extraction: Gentle solubilization using detergents that maintain protein structure (DDM, LMNG, or digitonin) is critical. Screening multiple detergents at various concentrations is advisable to optimize extraction efficiency while preserving function.

  • Affinity chromatography: Incorporating affinity tags (His6, FLAG, Strep-II) facilitates initial purification. Positioning these tags to minimize interference with function is important—N-terminal tags are often preferred for membrane proteins when C-terminal regions are functionally critical.

  • Size exclusion chromatography: This step separates properly folded protein from aggregates and removes detergent micelles. For ccsA, which normally functions in a complex with CcsB, careful analysis of elution profiles can provide information about oligomeric state.

  • Ion exchange chromatography: When higher purity is required, ion exchange can provide additional separation based on surface charge distribution.

Throughout purification, it's essential to monitor protein stability and function. For ccsA, this might include spectroscopic assays to assess heme binding capacity or reconstitution assays with partner proteins to verify functional integrity.

How can functional activity of recombinant ccsA be assessed in vitro?

Establishing reliable functional assays for recombinant ccsA is essential for verifying that the expressed protein retains its native activity. Several approaches can be employed:

  • Heme binding assays: Since ccsA is involved in heme handling, spectroscopic techniques (UV-visible spectroscopy, resonance Raman) can assess heme binding capacity and coordination environment.

  • Reconstitution with partner proteins: Assessing interaction with recombinant CcsB using techniques like surface plasmon resonance or pull-down assays can verify that ccsA retains its ability to form the cytochrome c synthase complex.

  • Proteoliposome reconstitution: Incorporating purified ccsA into liposomes, alone or with CcsB, enables assessment of membrane integration and potentially heme transport activity.

  • In vitro cytochrome c synthesis: The ultimate functional test involves reconstituting the complete System II pathway using purified components (ccsA, CcsB, CcdA, CcsX, apocytochrome c, and heme) to monitor formation of mature cytochrome c.

  • Complementation assays: If direct biochemical assays prove challenging, functional complementation of ccsA-deficient bacterial or yeast strains can provide evidence of activity.

These functional assays should be performed under conditions that mimic the native environment, including appropriate pH, ionic strength, and redox state, as these factors can significantly influence the activity of cytochrome c biogenesis components.

How does Illicium oligandrum ccsA compare to homologs in other basal angiosperms?

Comparative analysis of ccsA across basal angiosperms provides insights into evolutionary conservation and potential functional adaptations. The chloroplast genomes of Illicium oligandrum (148,553 bp), Schisandra sphenanthera (146,853 bp), and Schisandra chinensis (146,730 bp) are relatively similar in size and gene content, including the presence of ccsA . This conservation suggests shared functional constraints across these evolutionarily ancient plant lineages.

The table below summarizes the chloroplast genome characteristics across several basal angiosperms:

SpeciesTotal Length (bp)LSC Length (bp)SSC Length (bp)IR Length (bp)
Schisandra sphenanthera146,85395,62718,29216,467
Schisandra chinensis146,73097,35120,30515,058
Illicium oligandrum148,55397,14420,26715,571
Amborella trichopoda162,68690,97018,41426,651
Nymphaea alba159,93090,01419,56225,177
Trithuria inconspicua165,38984,4686,35437,284
Average155,02492,59617,19922,702

What differences exist between plant and bacterial ccsA proteins?

Plant ccsA proteins, including that from Illicium oligandrum, are encoded in the chloroplast genome and function specifically in chloroplast cytochrome c maturation . In contrast, bacterial ccsA proteins are encoded in the bacterial genome and operate in the context of the bacterial cell membrane . This different genomic location and cellular context may influence regulatory mechanisms and protein interactions.

The bacterial System II sometimes exhibits variations in component organization, with some ε-proteobacteria containing CcsBA fusion proteins that constitute single polypeptide cytochrome c synthases . Such fusion proteins have been particularly valuable for functional studies. Plant systems typically maintain separate ccsA and CcsB proteins, suggesting potential differences in the dynamics and regulation of complex formation.

Additionally, plant ccsA proteins function in the context of chloroplast thylakoid membranes, which have unique lipid compositions and protein crowding environments different from bacterial membranes. These environmental differences may be reflected in adaptive features of the protein sequence and structure that optimize function in plant-specific contexts.

What emerging technologies could advance our understanding of ccsA function?

Several cutting-edge technologies hold promise for deepening our understanding of ccsA structure, function, and interactions:

  • Cryo-electron microscopy: The recent advances in cryo-EM resolution could enable structural determination of the ccsA-CcsB complex, providing unprecedented insights into the molecular mechanisms of cytochrome c synthase activity.

  • Native mass spectrometry: This technique allows analysis of intact membrane protein complexes in near-native states, potentially revealing stoichiometry and dynamics of the cytochrome c synthase complex.

  • Single-molecule techniques: Approaches like single-molecule FRET could elucidate the conformational changes associated with heme transport and attachment processes.

  • Advanced genetic tools: CRISPR-Cas9 genome editing in plant chloroplasts could facilitate precise manipulation of ccsA to investigate structure-function relationships in vivo.

  • Synthetic biology approaches: Reconstitution of minimal cytochrome c biogenesis systems in artificial membrane environments could provide controlled experimental platforms for dissecting individual steps in the process.

These technological approaches, combined with traditional biochemical and genetic methods, could resolve persistent questions about how ccsA and other System II components orchestrate the complex process of cytochrome c maturation.

How might functional studies of ccsA inform synthetic biology applications?

Understanding the molecular mechanisms of ccsA function could inform various synthetic biology applications:

  • Engineered electron transport chains: Detailed knowledge of cytochrome c biogenesis could enable the design of optimized electron transport systems for biotechnological applications, including microbial fuel cells or photosynthetic bioproduction platforms.

  • Heterologous expression of challenging cytochromes: Insights from ccsA studies could improve strategies for producing functional c-type cytochromes in heterologous hosts, overcoming current limitations in producing these complex proteins.

  • Designer heme-binding proteins: The heme attachment mechanisms facilitated by ccsA could inspire the design of novel heme-binding proteins with customized redox properties for applications in sensing, catalysis, or energy conversion.

  • Minimal synthetic cells: As efforts advance to create minimal cells with defined components, understanding essential processes like cytochrome c biogenesis becomes crucial for incorporating functional electron transport capabilities.

By elucidating the fundamental principles of how ccsA contributes to cytochrome c maturation, researchers can apply this knowledge to design and optimize biological systems with enhanced or novel functions related to electron transport and energy conversion.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.