Recombinant Illicium oligandrum NAD (P)H-quinone oxidoreductase subunit 1, chloroplastic

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant Illicium oligandrum NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic (UniProt ID: A6MN00), is a 364-amino-acid protein expressed in Escherichia coli with an N-terminal His tag for purification . It belongs to the NADH-plastoquinone oxidoreductase family and is encoded by the ndhA gene .

Key Features:

PropertyDescription
SpeciesIllicium oligandrum (Star anise)
Expression SystemE. coli
TagN-terminal His tag
LengthFull-length (1–364 amino acids)
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Production Protocol:

StepDetails
HostE. coli
VectorpET or similar expression system
PurificationAffinity chromatography (Ni-NTA for His tag)
ReconstitutionLyophilized protein solubilized in Tris/PBS buffer with 50% glycerol
Activity AssayNot explicitly reported; inferred from homologous systems

Stability:

  • Storage: -20°C/-80°C (avoid repeated freeze-thaw cycles) .

  • Buffer: Tris/PBS with 6% trehalose (prevents aggregation) .

Research Applications

  1. Enzymatic Studies: Mechanistic analysis of quinone reduction in chloroplasts.

  2. Structural Biology: Crystallization trials to resolve active-site architecture.

  3. Biotechnological Engineering: Enhancing stress tolerance in plants via redox pathway modulation .

Limitations and Future Directions

  • Functional Data Gap: Direct enzymatic activity assays for the recombinant protein are lacking .

  • Species-Specific Roles: The contribution of Illicium NDC1 to secondary metabolism (e.g., terpenoid biosynthesis) remains unexplored.

  • Structural Insights: Cryo-EM or X-ray crystallography could clarify substrate-binding dynamics.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-364
Protein Length
full length protein
Species
Illicium oligandrum (Star anise)
Target Names
ndhA
Target Protein Sequence
MIIDTTEVQAINSFSRSESSKEFYGLIWLLVPIFTPVSGILIGVLVIVWLEREISAGIQQ RIGPEYAGPLGILQALADGTKLLFKEDLLPSRGDIRLFSVGPSIAVISILLSYSVIPFGY RLIIADISIGVFLWIAISSIAPIGLLMSGYGSNNKYSFSGGLRAAAQSISYEIPLTPCVL SISLRLSNSSSTVDIVEAQSKYGFCGWNLWRQPIGFIVFLISSLAECERLPFDLPEAEEE LVAGYQTEYSGIKSGLFYVASYLNLLVSSLFVTVLYLGGWNLSIPYISIPELFGINKTGG VFGSTIGILITLAKAYLFLFVPITTRWTLPRMRMDQLLNLGWKFLLPIALGNLLLTTSSQ LLSF
Uniprot No.

Target Background

Function
NDH transfers electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. It couples the redox reaction to proton translocation, thereby conserving the redox energy in a proton gradient.
Protein Families
Complex I subunit 1 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase and what is its primary function in chloroplasts?

NAD(P)H-quinone oxidoreductase is an enzyme that catalyzes the transfer of electrons from NAD(P)H to quinones. In chloroplasts, it plays a crucial role in redox metabolism by reducing plastoquinones, which are essential components of electron transport chains. This enzyme is particularly important for plastoquinone reduction in plastoglobules (chloroplast lipid droplets), functioning in a pathway parallel to cyclic and chlororespiratory electron flow .

The enzyme exhibits a bi-modular architecture with:

  • A catalytic domain (domain 1)

  • A NAD(P)H-binding domain (domain 2)

  • Connection between domains via helix structures

This structural arrangement facilitates efficient electron transfer from NADPH to various quinone substrates, contributing to the maintenance of redox homeostasis within the chloroplast.

How does Illicium oligandrum NAD(P)H-quinone oxidoreductase compare to homologous enzymes from other species?

While specific structural data for Illicium oligandrum NAD(P)H-quinone oxidoreductase is limited in the provided research, comparative analyses of homologous enzymes reveal several key features:

  • Conserved topology across species with variations in active sites suggesting differences in substrate specificities

  • Potential dual localization in both mitochondria and chloroplasts, as observed in other plant species

  • Association with plastoglobules, which serve as sites for both prenylquinone metabolism and storage

Illicium oligandrum, belonging to the basal angiosperm lineage, likely shares structural similarities with other plant NAD(P)H-quinone oxidoreductases while potentially exhibiting species-specific adaptations related to its evolutionary position .

What distinguishes chloroplastic NAD(P)H-quinone oxidoreductase from its mitochondrial counterparts?

FeatureChloroplastic NAD(P)H-QORMitochondrial NAD(P)H-QOR
Primary substratePlastoquinoneUbiquinone
Cellular locationPlastoglobules, thylakoid membranesInner mitochondrial membrane
Electron donor preferenceHigher affinity for NADPHHigher affinity for NADH
Role in metabolismPlastoquinone reduction, vitamin K1 productionRespiratory chain, ROS management
OriginTypically cyanobacterial originDiverse evolutionary origins

The chloroplastic enzyme, particularly NDC1 (NAD(P)H dehydrogenase C1), appears to be of cyanobacterial origin and demonstrates dual localization potential. Unlike its mitochondrial counterparts, it specifically affects the redox state of the plastoquinone pool and is essential for vitamin K1 production and normal plastochromanol-8 accumulation .

What are the optimal conditions for recombinant expression of Illicium oligandrum NAD(P)H-quinone oxidoreductase?

Based on general recombinant protein expression protocols and data from similar enzymes, the following conditions are recommended:

Expression System Selection:

  • E. coli BL21(DE3) for basic expression

  • Insect cell systems (Sf9, High Five) for enhanced folding of plant proteins

  • Plant-based expression systems for maintaining native post-translational modifications

Expression Parameters:

  • Induction at OD₆₀₀ of 0.6-0.8 with 0.1-0.5 mM IPTG (for E. coli systems)

  • Post-induction temperature of 18-20°C to enhance solubility

  • Expression duration of 16-18 hours for optimal yield-to-solubility ratio

  • Supplementation with riboflavin (10 μM) to enhance cofactor incorporation

The chloroplastic targeting sequence should be removed from the expression construct to improve solubility while maintaining enzymatic function .

What purification strategy yields the highest activity for recombinant NAD(P)H-quinone oxidoreductase?

A multi-step purification approach is recommended:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged protein

  • Intermediate Purification: Ion exchange chromatography (typically anion exchange using Q-Sepharose)

  • Polishing Step: Size exclusion chromatography to obtain homogeneous protein

Critical Buffer Components:

  • 50 mM Tris-HCl or phosphate buffer (pH 7.5-8.0)

  • 150-300 mM NaCl

  • 5% glycerol for stability

  • 0.5-1 mM DTT or 2-mercaptoethanol to maintain reduced cysteines

  • 0.1 mM EDTA to prevent metal-catalyzed oxidation

Gel filtration analysis of similar NAD(P)H-quinone oxidoreductases indicates that the enzyme likely functions as a tetramer in solution , which should be considered when designing purification strategies.

What assays are most effective for measuring the enzymatic activity of Illicium oligandrum NAD(P)H-quinone oxidoreductase?

Spectrophotometric Assays:

  • NADPH Oxidation Assay: Monitor decrease in absorbance at 340 nm (ε = 6,220 M⁻¹cm⁻¹)

    • Reaction mixture: 50 mM Tris-HCl (pH 7.5), 150 μM NADPH, 100 μM quinone substrate, enzyme

    • Calculate activity: ΔA₃₄₀/min converted to μmol NADPH oxidized/min

  • Dichlorophenolindophenol (DCPIP) Reduction Assay:

    • Monitor decrease in absorbance at 600 nm

    • Useful as an artificial electron acceptor

  • Decyl-PQ Assay: Using decyl-plastoquinone as substrate to mimic natural substrate

Specialized Assays:

  • Plastoglobule-Based Assay: Using purified plastoglobules as substrate-containing particles to assess native substrate reduction

  • Electrochemical Detection: For real-time monitoring of quinone reduction

How does substrate specificity vary among NAD(P)H-quinone oxidoreductases from different plant species?

NAD(P)H-quinone oxidoreductases exhibit varying substrate preferences depending on their biological source:

Enzyme SourcePreferred SubstratesRelative ActivitiesComments
P. capsici QOR9,10-phenanthrenequinone100%Prefers large substrates
Plant NDC1Plastoquinone85-100%Essential for plastoquinone pool redox state
Generic plant QORsUbiquinone40-60%Lower efficiency
Generic plant QORsBenzoquinone30-50%Artificial substrate

Structural analyses indicate that active site variations among homologous enzymes are responsible for these differences in substrate specificity . The enzyme from Illicium oligandrum would likely share characteristics with other basal angiosperms but may exhibit unique substrate preferences due to its evolutionary position.

What factors affect the stability and activity of recombinant NAD(P)H-quinone oxidoreductase?

Several factors significantly impact enzyme stability and activity:

Physical Factors:

  • Temperature: Optimal activity typically at 25-30°C; stability decreases above 40°C

  • pH: Maximum activity usually between pH 7.0-8.0

  • Ionic Strength: Moderate salt concentrations (150-300 mM) generally stabilize the enzyme

Chemical Factors:

  • Reducing Agents: Required to maintain thiol groups (DTT, β-mercaptoethanol)

  • Metal Ions: Some QORs show enhanced activity with Zn²⁺ or Mg²⁺

  • Glycerol/Sugars: 5-10% glycerol enhances stability during storage

Storage Considerations:

  • Best preserved at -80°C in buffer containing glycerol

  • Avoid repeated freeze-thaw cycles

  • Addition of NADPH (0.1 mM) may protect the active site during storage

What are the key structural features of the NAD(P)H binding site in quinone oxidoreductases?

The NADPH binding site in quinone oxidoreductases exhibits several conserved features:

  • Binding Groove Architecture:

    • The NADPH binds in a cleft between domain 1 and domain 2

    • The co-factor is embedded in a positively charged cavity

  • Key Binding Interactions:

    • The adenine ring is typically wrapped in a groove formed by residues via van der Waals contacts

    • Aromatic residues (e.g., tyrosine) often stack against the adenine ring

    • The phosphate group attached to adenosine ribose is encompassed by positively charged residues

    • The pyrophosphate moiety establishes hydrogen bonds with specific residues

    • The nicotinamide moiety fits into an open cavity and forms strong interactions with specific residues

  • Orientation Considerations:

    • In some QORs, the adenine ring of NADPH exhibits a mirrored orientation compared to NADPH from other species

    • This orientation difference may contribute to NADPH stability and is attributed to different residue compositions in the adenine ring-binding cavity

How do mutations in the active site affect catalytic efficiency and substrate specificity?

Mutations in the active site can significantly alter the enzyme's catalytic properties:

Mutation TypeEffect on CatalysisEffect on Substrate SpecificityStructural Consequence
Aromatic residue substitutionsAltered π-stacking with substratesChanged preference for ring structuresModified substrate binding pocket
Charged residue mutationsAltered electrostatic interactionsChanged preference for charged substratesModified charge distribution
Hydrophobic pocket alterationsChanged substrate positioningShifted preference based on substrate sizeReshaped binding cavity
Catalytic residue mutationsReduced catalytic efficiencyMinimal effect on bindingDisrupted electron transfer

Site-directed mutagenesis studies of similar enzymes suggest that specific residues in the active site are critical for maintaining proper orientation of both NADPH and quinone substrates for efficient electron transfer .

What techniques are most effective for determining the crystal structure of plant NAD(P)H-quinone oxidoreductases?

The crystal structure determination of plant NAD(P)H-quinone oxidoreductases typically involves:

Protein Preparation:

  • High-purity protein (>95% by SDS-PAGE)

  • Concentrated to 10-15 mg/mL

  • Buffer optimization through thermal stability assays

Crystallization Methods:

  • Vapor Diffusion: Sitting or hanging drop methods

  • Microseeding: For improving crystal quality

  • Co-crystallization: With NADPH and/or substrate analogs

Optimized Conditions:

  • PEG-based precipitants (PEG 3350, PEG 4000)

  • pH range 6.5-8.0

  • Addition of 5-20% glycerol or ethylene glycol

Structure Determination Workflow:

  • Data collection at synchrotron radiation facilities

  • Phase determination through molecular replacement using homologous structures

  • Model building and refinement

  • Validation of final structure

The crystal structure of PcQOR complexed with NADPH at 2.4 Å resolution provides a valuable template for molecular replacement approaches .

What is the role of NAD(P)H-quinone oxidoreductase in plant stress responses?

NAD(P)H-quinone oxidoreductases play critical roles in plant stress responses through several mechanisms:

  • Oxidative Stress Protection:

    • Reduction of quinones prevents their participation in redox cycling

    • Maintains reduced plastoquinone pool to buffer oxidative damage

    • Contributes to ROS (reactive oxygen species) scavenging systems

  • Energy Balance Regulation:

    • Provides alternative electron transfer pathways during stress

    • Helps maintain ATP production when photosynthetic electron transport is impaired

    • Supports cellular NADPH/NADP+ ratio homeostasis

  • Secondary Metabolite Production:

    • May be involved in biosynthesis of protective compounds

    • Contributes to production of vitamins with antioxidant properties

How does the subcellular localization of NAD(P)H-quinone oxidoreductase affect its function?

The subcellular localization of NAD(P)H-quinone oxidoreductase critically determines its functional role:

Plastoglobule Localization:

  • Allows access to plastoquinone reservoir not immediately involved in linear electron transport

  • Enables reduction of plastoglobule-localized plastoquinone pool

  • Facilitates vitamin K1 and plastochromanol-8 metabolism

Dual Localization:

  • Some NAD(P)H-quinone oxidoreductases show dual targeting to both mitochondria and chloroplasts

  • This dual localization allows coordination between organellar redox states

  • Provides flexibility in responding to different cellular stresses

Functional Implications:

  • Compartmentalization separates different substrate pools

  • Allows differential regulation of enzyme activity

  • Enables specific interactions with organelle-specific metabolic pathways

The association with plastoglobules is particularly significant as these structures are important sites for both prenylquinone metabolism and storage .

What is the relationship between NAD(P)H-quinone oxidoreductase activity and secondary metabolite production in Illicium species?

Illicium species, including Illicium oligandrum, are known for producing various bioactive secondary metabolites. The relationship between NAD(P)H-quinone oxidoreductase activity and these compounds likely involves:

  • Redox Balance Maintenance:

    • NAD(P)H-quinone oxidoreductase helps maintain cellular redox homeostasis

    • Proper redox balance is critical for secondary metabolite biosynthetic pathways

  • Prenylquinone Metabolism:

    • The enzyme contributes to metabolism of plastoquinone, tocopherol, and other prenylquinones

    • These compounds can serve as precursors or regulators for secondary metabolite production

  • Stress Response Coordination:

    • Secondary metabolite production is often stress-induced

    • NAD(P)H-quinone oxidoreductase activity may signal stress conditions

    • Coordinated regulation of stress response and secondary metabolism

Illicium species are known for their aromatic compounds which may be influenced by redox-related enzymes. The leaves of Illicium species contain chemicals that are toxic to insects and animals, suggesting sophisticated secondary metabolite production systems that may involve NAD(P)H-dependent enzymes .

What computational methods are useful for predicting substrate interactions with Illicium oligandrum NAD(P)H-quinone oxidoreductase?

Molecular Docking Approaches:

  • Rigid Docking: Initial screening of potential substrates

  • Flexible Docking: Accommodates protein flexibility during substrate binding

  • Ensemble Docking: Uses multiple protein conformations to account for structural dynamics

Molecular Dynamics Simulations:

  • Explicit solvent MD simulations (100-500 ns) to examine binding stability

  • Free energy calculations (MM-PBSA, MM-GBSA) to rank substrate binding affinities

  • Enhanced sampling methods to capture binding/unbinding events

Structure-Based Virtual Screening:

  • Pharmacophore modeling based on known substrates

  • Shape-based screening to identify molecules with complementary geometry

  • Electrostatic complementarity analysis

Machine Learning Integration:

  • Neural network models trained on known enzyme-substrate interactions

  • Feature extraction from binding site properties

  • Prediction of binding affinity and catalytic efficiency

These computational approaches can utilize the structural features identified in homologous enzymes, such as the bi-modular architecture observed in PcQOR .

How can CRISPR-Cas9 genome editing be used to study NAD(P)H-quinone oxidoreductase function in plants?

CRISPR-Cas9 offers powerful approaches for studying NAD(P)H-quinone oxidoreductase function:

Gene Knockout Strategies:

  • Complete gene knockout to assess loss-of-function phenotypes

  • Domain-specific disruptions to identify critical functional regions

  • Promoter editing to alter expression levels

Precision Engineering:

  • Specific amino acid substitutions at active sites

  • Introduction of affinity tags for in vivo pulldown experiments

  • Creation of conditional knockouts using inducible systems

Workflow for CRISPR-Cas9 Editing:

  • Design guide RNAs targeting exonic regions of the NAD(P)H-quinone oxidoreductase gene

  • Create repair templates for specific modifications

  • Transform plant cells using appropriate methods (Agrobacterium, biolistics)

  • Screen transformants for desired modifications

  • Analyze phenotypic changes in homozygous mutants

Phenotypic Analysis:

  • Measure changes in quinone reduction capacity

  • Assess impacts on prenylquinone metabolism

  • Evaluate stress tolerance phenotypes

  • Quantify changes in plastoglobule size/number

  • Analyze vitamin production (especially vitamin K1)

What advanced mass spectrometry techniques are most suitable for studying post-translational modifications of NAD(P)H-quinone oxidoreductase?

Sample Preparation Strategies:

  • Enrichment of modified peptides (IMAC for phosphopeptides, lectin affinity for glycopeptides)

  • Multiple protease digestions to improve sequence coverage

  • Fractionation methods to reduce sample complexity

MS Instrumentation and Methods:

  • High-Resolution MS: Orbitrap or Q-TOF for accurate mass determination

  • Fragmentation Techniques:

    • Electron transfer dissociation (ETD) for labile modifications

    • Higher-energy collisional dissociation (HCD) for general PTM mapping

    • Combination approaches (EThcD) for comprehensive analysis

  • Targeted Analysis: Parallel reaction monitoring (PRM) or multiple reaction monitoring (MRM) for quantitative analysis of specific modifications

Data Analysis Approaches:

  • Open search algorithms to identify unknown modifications

  • PTM localization scoring to pinpoint modification sites

  • Quantitative comparison across different conditions

Key PTMs to Monitor:

  • Phosphorylation (regulatory function)

  • Acetylation (regulatory function)

  • Oxidative modifications (indicative of enzyme aging/damage)

  • Transit peptide processing (important for chloroplastic localization)

What are the most promising approaches for enhancing the catalytic efficiency of recombinant NAD(P)H-quinone oxidoreductase?

Protein Engineering Strategies:

  • Rational Design:

    • Modify active site residues based on structural analysis

    • Optimize NADPH binding site for improved cofactor affinity

    • Engineer substrate binding pocket to accommodate target quinones

  • Directed Evolution:

    • Error-prone PCR to generate variant libraries

    • Activity-based screening methods

    • Iterative selection for improved catalytic properties

  • Computational Design:

    • In silico prediction of beneficial mutations

    • De novo active site design

    • Molecular dynamics-guided optimization

Expression Optimization:

  • Codon optimization for heterologous expression

  • Fusion tags for improved solubility and stability

  • Co-expression with chaperones to enhance folding

Catalytic Parameters to Target:

  • Higher k<sub>cat</sub> for increased turnover

  • Lower K<sub>M</sub> for improved substrate binding

  • Broader substrate range

  • Enhanced thermostability

How might structural comparisons between NAD(P)H-quinone oxidoreductases from various plant lineages inform evolutionary adaptations of the enzyme?

Structural comparisons across plant lineages offer valuable insights into evolutionary adaptations:

Evolutionary Analysis Framework:

  • Sequence-based phylogenetic analysis to establish evolutionary relationships

  • Structural superposition to identify conserved and divergent regions

  • Ancestral sequence reconstruction to infer evolutionary trajectories

Key Evolutionary Questions:

  • How has substrate specificity evolved across plant lineages?

  • What structural adaptations correlate with habitat-specific stresses?

  • How has subcellular targeting evolved (dual localization vs. specific targeting)?

  • What is the evolutionary relationship between mitochondrial and chloroplastic isoforms?

Comparative Approaches:

  • Analysis of basal angiosperms (including Illicium oligandrum) versus more derived lineages

  • Comparison of enzymes from plants adapted to different environmental niches

  • Examination of structural variations in relation to genome expansion/contraction events

Expected Outcomes:

  • Identification of lineage-specific structural adaptations

  • Understanding of functional diversification across plant evolution

  • Insights into the co-evolution of enzyme structure and plant metabolism

What role might NAD(P)H-quinone oxidoreductase play in adaptation of Illicium species to different environmental conditions?

NAD(P)H-quinone oxidoreductase likely contributes to environmental adaptation in Illicium species through several mechanisms:

Stress Response Roles:

  • Temperature Adaptation:

    • Maintenance of electron transport during temperature fluctuations

    • Protection against cold-induced oxidative stress

    • Thermotolerance through redox homeostasis

  • Light Intensity Adaptation:

    • Alternative electron flow pathways during high light conditions

    • Photoprotective mechanisms through plastoquinone reduction

    • Maintenance of photosystem function during fluctuating light

  • Drought and Salinity Tolerance:

    • ROS scavenging during water limitation

    • Maintenance of essential metabolic functions under stress

    • Production of protective secondary metabolites

Habitat-Specific Adaptations:
Illicium species, including I. oligandrum, demonstrate specific adaptations to their natural habitats. For example, Illicium species are described as perfect understory shrubs for the piney woods, being deer resistant with aromatic leaves that contain chemicals toxic to insects and animals . These adaptations may be linked to specialized functions of enzymes like NAD(P)H-quinone oxidoreductase.

Research Approaches:

  • Comparative analysis of enzyme properties across Illicium species from different habitats

  • Gene expression profiling under various stress conditions

  • Metabolomic analysis to correlate enzyme activity with protective compound production

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.