Recombinant Illicium oligandrum NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics

The recombinant protein is derived from Illicium oligandrum (star anise), a plant species, and corresponds to UniProt ID A6MMU9 . Key attributes include:

  • Molecular Weight: ~45 kDa (estimated from sequence length and expression systems) .

  • Sequence: Full-length (1–120 amino acids) with a His-tag for purification . A partial sequence is:
    MFLLHEYDIFWAFLMISSVIPILAFLISGVLAPIREGPEKLSSYESGIEPMGDAWLQFRI .

  • Function: Couples redox reactions to proton translocation, supporting photosynthetic electron transport and carbon assimilation .

Production and Purification

This recombinant protein is typically expressed in E. coli and purified via affinity chromatography (His-tag) . Key production parameters include:

ParameterDetails
Expression SystemE. coli (in vitro)
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Storage BufferTris-based buffer with 50% glycerol, pH 8.0
Storage-20°C or -80°C; avoid repeated freeze-thaw cycles

Applications in Research

The recombinant ndhC protein is utilized in diverse biochemical and structural studies:

ApplicationPurposeExample
Enzymatic ActivityAssess electron transfer kinetics and proton translocation efficiencyIn vitro assays with plastoquinone
Structural StudiesDetermine subunit interactions within the NDH complexX-ray crystallography or cryo-EM
Antibody DevelopmentGenerate specific antibodies for immunodetection or ELISA assaysRecombinant protein as antigen
Protein InteractionsIdentify binding partners (e.g., other NDH subunits or plastid proteins)Co-IP or surface plasmon resonance

Role in Photosynthesis

The NDH complex, including subunit 3, is critical for:

  • Cyclic Electron Flow: Enhances ATP synthesis by shuttling electrons via FMN and iron-sulfur centers .

  • Carbon Assimilation: Aids in CO₂ fixation by modulating stromal pH and redox balance .

Functional Insights

  • Subunit 3 likely stabilizes the NDH complex structure and facilitates quinone binding .

  • Mutations in ndhC homologs (e.g., in Arabidopsis) impair photosynthetic efficiency under stress conditions, highlighting its evolutionary conservation .

Comparative Analysis

The Illicium oligandrum ndhC differs from homologs in other organisms, such as Mesostigma viride (UniProt Q9MUQ9), in sequence motifs and potential post-translational modifications .

OrganismUniProt IDSequence IdentityKey Differences
Illicium oligandrumA6MMU9N/APlant-specific chloroplast localization
Mesostigma virideQ9MUQ9~70%Algal-specific adaptations

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Specify your desired tag type for preferential development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Illicium oligandrum (Star anise)
Target Names
ndhC
Target Protein Sequence
MFLLHEYDIFWAFLMISSVIPILAFLISGVLAPIREGPEKLSSYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSAFIEALIFVLIPIVGSVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H dehydrogenase) facilitates electron transfer from NAD(P)H:plastoquinone to quinones within the photosynthetic and potentially chloroplast respiratory chains, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, plastoquinone is the presumed immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, thus conserving redox energy within a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase subunit 3, and what role does it play in chloroplasts?

NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is a critical component of the chloroplastic NAD(P)H dehydrogenase complex involved in cyclic electron transport around photosystem I. This enzyme catalyzes the reduction of quinones using either NADH or NADPH as electron donors. In chloroplasts, this activity contributes to ATP synthesis without simultaneous NADPH production, helping plants balance their ATP/NADPH ratio, particularly under stress conditions. The subunit 3 specifically contributes to the membrane-embedded portion of the complex and is encoded by the chloroplast genome (ndhC gene) .

How does the Illicium oligandrum NAD(P)H-quinone oxidoreductase compare to those from other plant species?

While the search results don't provide direct comparative studies specific to Illicium oligandrum, we can observe that NAD(P)H-quinone oxidoreductase subunit 3 is widely conserved across diverse plant species, including Zygnema circumcarinatum, Eucalyptus globulus, Nicotiana tomentosiformis, Solanum lycopersicum, and many others . This conservation suggests an essential evolutionary role. Structural differences likely reflect adaptations to specific ecological niches, as Illicium oligandrum (star anise) evolved in different environmental conditions compared to species like Solanum (nightshades) or Eucalyptus. Future comparative studies examining amino acid sequences and structural models would help elucidate these species-specific adaptations.

What are the optimal storage conditions for Recombinant Illicium oligandrum NAD(P)H-quinone oxidoreductase?

Based on storage recommendations for similar recombinant proteins from Illicium oligandrum:

  • Short-term storage: Store working aliquots at 4°C for up to one week

  • Medium-term storage: Store at -20°C

  • Long-term storage: Conserve at -20°C or -80°C

  • Storage buffer: Typically maintained in Tris-based buffer with 50% glycerol, optimized for protein stability

  • Important note: Repeated freezing and thawing is not recommended as it may compromise protein activity

These conditions help maintain structural integrity and enzymatic activity over time. For research requiring prolonged study periods, it's advisable to create multiple small aliquots to avoid repeated freeze-thaw cycles.

How can researchers measure NAD(P)H-quinone oxidoreductase activity accurately?

NAD(P)H-quinone oxidoreductase activity can be measured through spectrophotometric assays monitoring NAD(P)H oxidation at 340 nm. A standardized protocol based on the search results would include:

  • Reaction mixture preparation: 50 µM quinone, 500 µM NAD(P)H, and 0.1-10 µg enzyme in 20 mM Tris-HCl buffer (pH 8) containing 100 mM NaCl and 5% (v/v) DMSO.

  • Assay procedure:

    • Set up reactions in UV-transparent 96-well plates with 100 µL reaction volume

    • Add 95 µL of enzyme/NAD(P)H solution to 5 µL quinone to initiate the reaction

    • Monitor absorbance decrease at 340 nm using a plate reader (e.g., Flurostar Omega)

    • Include controls without enzyme to account for non-enzymatic oxidation

  • Data analysis:

    • Calculate rates by fitting the change in optical density over time

    • Determine enzyme activity using the extinction coefficient of NAD(P)H (6,220 M⁻¹cm⁻¹)

    • Express activity as µmol NAD(P)H oxidized per minute per mg protein

For comprehensive characterization, test multiple quinone substrates to establish substrate preference profiles.

What heterologous expression systems are most effective for producing recombinant NAD(P)H-quinone oxidoreductases?

Based on successful expression approaches for similar enzymes:

  • Bacterial expression systems:

    • Escherichia coli remains the most commonly used host for NAD(P)H-quinone oxidoreductases

    • Recommended vectors: pET series (particularly pET21d+) with non-cleavable C-terminal hexahistidine tags

    • Purification strategy: Immobilized metal affinity chromatography (IMAC) using nickel or cobalt resins

  • Fungal expression systems:

    • Aspergillus oryzae NSAR1 (niaD−, sC−, adeA−, ΔargB) has been successfully used for expressing similar enzymes

    • Transformation method: Protoplast–polyethylene glycol method

    • Culture media: DPY medium for protoplast preparation, MA medium for transformant selection

    • Verification: PCR confirmation of successful gene insertion

  • Expression optimization parameters:

    • Induction temperature: Lower temperatures (15-25°C) often yield higher soluble protein

    • Induction duration: Extended induction periods (16-24h) may improve yield

    • Co-expression with chaperones may increase proper folding for membrane-associated proteins

How do structural features of NAD(P)H-quinone oxidoreductases influence their catalytic efficiency?

Crystallographic studies of similar quinone oxidoreductases reveal critical structural features affecting catalytic efficiency:

  • Active site architecture:

    • The active site forms as a groove between two domains

    • NADPH binding causes significant conformational changes

    • Wider substrate-binding sites correlate with ability to accommodate larger quinone substrates

  • Key structural parameters affecting function:

    ParameterTypical ValuesFunctional Significance
    Space groupP3₁2₁ or P3₂2₁Defines crystal packing and dimer arrangement
    Cell dimensionsa=b≈81-84Å, c≈109-185ÅReflects protein size and oligomeric state
    Resolution1.5-2.4ÅHigher resolution provides better structural insights
    R-factorsRwork/Rfree ≈17-23%Quality indicators for structural model
    Ramachandran plot>95% in favored regionsIndicates proper protein folding
  • FMN binding:

    • NAD(P)H-quinone oxidoreductases typically contain non-covalently bound FMN

    • The flavin cofactor shows characteristic absorption maximum at 455 nm

    • The cofactor position influences electron transfer efficiency between NAD(P)H and quinone substrates

Understanding these structural features provides opportunities for rational enzyme engineering to enhance catalytic properties.

What approaches can resolve contradictory data regarding substrate specificity of NAD(P)H-quinone oxidoreductases?

Researchers encountering contradictory data regarding substrate specificity should consider the following methodological approaches:

  • Standardized kinetic characterization:

    • Determine Km and Vmax values for multiple substrates under identical conditions

    • Address solubility limitations by maintaining >5:1 molar ratio of NAD(P)H to quinone

    • Use linear portions of rate curves to avoid substrate limitation effects

  • Substrate panel comparison:

    • Test a diverse panel of quinones with varying structures to identify patterns in specificity

    • Compare natural quinones with synthetic analogs to determine structural requirements

    • Standardize substrate concentrations across experiments for valid comparisons

  • Structural analysis correlations:

    • Model enzyme-substrate interactions through molecular docking studies

    • Identify key residues involved in substrate binding through site-directed mutagenesis

    • Use multiple sequence alignments to identify conserved binding site features across species

  • Cross-validation approaches:

    • Compare in vitro and in vivo activities to resolve discrepancies

    • Test enzyme activity under varying pH, temperature, and ionic strength conditions

    • Use multiple detection methods (spectrophotometric, electrochemical, and radiolabeled) to validate observations

How can researchers investigate the physiological role of NAD(P)H-quinone oxidoreductase subunit 3 in plant stress responses?

Investigating the physiological role of NAD(P)H-quinone oxidoreductase subunit 3 in stress responses requires a multi-faceted approach:

  • Gene expression analysis:

    • Quantify ndhC transcript levels under various stress conditions (drought, high light, temperature extremes)

    • Compare expression patterns across different plant tissues and developmental stages

    • Use RNA-Seq to identify co-regulated genes that may function in the same pathways

  • Genetic modification approaches:

    • Generate knockout or knockdown lines targeting ndhC

    • Create overexpression lines with native or modified ndhC

    • Use CRISPR/Cas9 for precise genome editing to introduce specific mutations

    • Compare phenotypes under both normal and stress conditions

  • Biochemical characterization:

    • Measure NAD(P)H oxidation rates in isolated chloroplasts from stressed plants

    • Quantify redox status and ATP/NADPH ratios in wild-type versus modified plants

    • Determine the impact of environmental factors on enzyme kinetics parameters

  • Protein-protein interaction studies:

    • Identify interaction partners through co-immunoprecipitation or yeast two-hybrid assays

    • Map the complete NAD(P)H dehydrogenase complex composition under different conditions

    • Investigate how stress affects complex assembly and stability

These approaches collectively provide a comprehensive understanding of how NAD(P)H-quinone oxidoreductase subunit 3 contributes to plant stress responses through modulating chloroplast energetics.

How might NAD(P)H-quinone oxidoreductases be utilized in biotechnological applications?

NAD(P)H-quinone oxidoreductases show significant potential for biotechnological applications:

  • Bioremediation applications:

    • These enzymes can reduce quinone-containing environmental pollutants

    • Engineered variants with enhanced substrate specificity could target specific contaminants

    • Immobilized enzyme systems could provide sustainable treatment technologies

  • Biocatalysis applications:

    • NAD(P)H-quinone oxidoreductases can be used for stereoselective reduction reactions

    • Integration into multi-enzyme cascades for complex chemical transformations

    • Production of high-value quinone derivatives for pharmaceutical applications

  • Metabolic engineering applications:

    • Expression in heterologous hosts to prevent overflow metabolism

    • Enhancement of energy production in cells with high energy demand

    • Balancing redox potential in engineered metabolic pathways

  • Analytical applications:

    • Development of biosensors for quinone detection in environmental or medical samples

    • High-throughput screening assays for drug discovery

    • Real-time monitoring of cellular redox status

What are the current challenges in structural studies of membrane-associated NAD(P)H-quinone oxidoreductases?

Researchers working on structural studies of membrane-associated NAD(P)H-quinone oxidoreductases face several challenges:

  • Protein purification challenges:

    • Maintaining native conformation during extraction from membranes

    • Selecting appropriate detergents that maintain protein stability

    • Achieving sufficient protein yield without compromising quality

  • Crystallization difficulties:

    • Membrane proteins typically have limited hydrophilic surface area for crystal contacts

    • Lipid/detergent micelles can interfere with crystallization packing

    • Conformational heterogeneity may hamper crystal formation

  • Data collection and processing complexities:

    • Membrane protein crystals often diffract to lower resolution

    • Anisotropic diffraction patterns require specialized processing

    • Phase determination may be challenging due to limited isomorphism

  • Emerging alternative approaches:

    • Cryo-electron microscopy for structure determination without crystallization

    • NMR spectroscopy for dynamic studies in membrane-mimicking environments

    • Computational approaches combining homology modeling with molecular dynamics simulations

These challenges necessitate innovative approaches to elucidate the detailed structural biology of membrane-associated NAD(P)H-quinone oxidoreductases.

How do post-translational modifications affect NAD(P)H-quinone oxidoreductase function and regulation?

While the search results don't provide specific information on post-translational modifications (PTMs) of Illicium oligandrum NAD(P)H-quinone oxidoreductase subunit 3, research on similar enzymes suggests several important considerations:

  • Types of PTMs potentially affecting function:

    • Phosphorylation: May regulate catalytic activity through conformational changes

    • Acetylation: Could affect protein-protein interactions within the complex

    • Redox modifications: Cysteine residues may form regulatory disulfide bridges

    • Glycosylation: Rare in chloroplast proteins but may affect stability

  • Experimental approaches to study PTMs:

    • Mass spectrometry-based proteomics to identify and quantify modifications

    • Site-directed mutagenesis of potentially modified residues

    • Comparative analysis of enzyme activity before and after treatment with modifying enzymes

    • In vivo labeling techniques to capture dynamic modification patterns

  • Physiological significance:

    • PTMs may serve as rapid response mechanisms to changing environmental conditions

    • Different modifications could create functional diversity from limited genetic resources

    • Cross-talk between different PTMs might integrate multiple signaling pathways

Understanding these modifications will provide insights into the fine-tuning of NAD(P)H-quinone oxidoreductase activity in response to changing cellular and environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.