The recombinant protein is derived from Illicium oligandrum (star anise), a plant species, and corresponds to UniProt ID A6MMU9 . Key attributes include:
Molecular Weight: ~45 kDa (estimated from sequence length and expression systems) .
Sequence: Full-length (1–120 amino acids) with a His-tag for purification . A partial sequence is:
MFLLHEYDIFWAFLMISSVIPILAFLISGVLAPIREGPEKLSSYESGIEPMGDAWLQFRI .
Function: Couples redox reactions to proton translocation, supporting photosynthetic electron transport and carbon assimilation .
This recombinant protein is typically expressed in E. coli and purified via affinity chromatography (His-tag) . Key production parameters include:
The recombinant ndhC protein is utilized in diverse biochemical and structural studies:
The NDH complex, including subunit 3, is critical for:
Cyclic Electron Flow: Enhances ATP synthesis by shuttling electrons via FMN and iron-sulfur centers .
Carbon Assimilation: Aids in CO₂ fixation by modulating stromal pH and redox balance .
Subunit 3 likely stabilizes the NDH complex structure and facilitates quinone binding .
Mutations in ndhC homologs (e.g., in Arabidopsis) impair photosynthetic efficiency under stress conditions, highlighting its evolutionary conservation .
The Illicium oligandrum ndhC differs from homologs in other organisms, such as Mesostigma viride (UniProt Q9MUQ9), in sequence motifs and potential post-translational modifications .
| Organism | UniProt ID | Sequence Identity | Key Differences |
|---|---|---|---|
| Illicium oligandrum | A6MMU9 | N/A | Plant-specific chloroplast localization |
| Mesostigma viride | Q9MUQ9 | ~70% | Algal-specific adaptations |
NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is a critical component of the chloroplastic NAD(P)H dehydrogenase complex involved in cyclic electron transport around photosystem I. This enzyme catalyzes the reduction of quinones using either NADH or NADPH as electron donors. In chloroplasts, this activity contributes to ATP synthesis without simultaneous NADPH production, helping plants balance their ATP/NADPH ratio, particularly under stress conditions. The subunit 3 specifically contributes to the membrane-embedded portion of the complex and is encoded by the chloroplast genome (ndhC gene) .
While the search results don't provide direct comparative studies specific to Illicium oligandrum, we can observe that NAD(P)H-quinone oxidoreductase subunit 3 is widely conserved across diverse plant species, including Zygnema circumcarinatum, Eucalyptus globulus, Nicotiana tomentosiformis, Solanum lycopersicum, and many others . This conservation suggests an essential evolutionary role. Structural differences likely reflect adaptations to specific ecological niches, as Illicium oligandrum (star anise) evolved in different environmental conditions compared to species like Solanum (nightshades) or Eucalyptus. Future comparative studies examining amino acid sequences and structural models would help elucidate these species-specific adaptations.
Based on storage recommendations for similar recombinant proteins from Illicium oligandrum:
Short-term storage: Store working aliquots at 4°C for up to one week
Medium-term storage: Store at -20°C
Long-term storage: Conserve at -20°C or -80°C
Storage buffer: Typically maintained in Tris-based buffer with 50% glycerol, optimized for protein stability
Important note: Repeated freezing and thawing is not recommended as it may compromise protein activity
These conditions help maintain structural integrity and enzymatic activity over time. For research requiring prolonged study periods, it's advisable to create multiple small aliquots to avoid repeated freeze-thaw cycles.
NAD(P)H-quinone oxidoreductase activity can be measured through spectrophotometric assays monitoring NAD(P)H oxidation at 340 nm. A standardized protocol based on the search results would include:
Reaction mixture preparation: 50 µM quinone, 500 µM NAD(P)H, and 0.1-10 µg enzyme in 20 mM Tris-HCl buffer (pH 8) containing 100 mM NaCl and 5% (v/v) DMSO.
Assay procedure:
Set up reactions in UV-transparent 96-well plates with 100 µL reaction volume
Add 95 µL of enzyme/NAD(P)H solution to 5 µL quinone to initiate the reaction
Monitor absorbance decrease at 340 nm using a plate reader (e.g., Flurostar Omega)
Include controls without enzyme to account for non-enzymatic oxidation
Data analysis:
For comprehensive characterization, test multiple quinone substrates to establish substrate preference profiles.
Based on successful expression approaches for similar enzymes:
Bacterial expression systems:
Fungal expression systems:
Aspergillus oryzae NSAR1 (niaD−, sC−, adeA−, ΔargB) has been successfully used for expressing similar enzymes
Transformation method: Protoplast–polyethylene glycol method
Culture media: DPY medium for protoplast preparation, MA medium for transformant selection
Expression optimization parameters:
Induction temperature: Lower temperatures (15-25°C) often yield higher soluble protein
Induction duration: Extended induction periods (16-24h) may improve yield
Co-expression with chaperones may increase proper folding for membrane-associated proteins
Crystallographic studies of similar quinone oxidoreductases reveal critical structural features affecting catalytic efficiency:
Active site architecture:
Key structural parameters affecting function:
| Parameter | Typical Values | Functional Significance |
|---|---|---|
| Space group | P3₁2₁ or P3₂2₁ | Defines crystal packing and dimer arrangement |
| Cell dimensions | a=b≈81-84Å, c≈109-185Å | Reflects protein size and oligomeric state |
| Resolution | 1.5-2.4Å | Higher resolution provides better structural insights |
| R-factors | Rwork/Rfree ≈17-23% | Quality indicators for structural model |
| Ramachandran plot | >95% in favored regions | Indicates proper protein folding |
FMN binding:
Understanding these structural features provides opportunities for rational enzyme engineering to enhance catalytic properties.
Researchers encountering contradictory data regarding substrate specificity should consider the following methodological approaches:
Standardized kinetic characterization:
Substrate panel comparison:
Structural analysis correlations:
Cross-validation approaches:
Investigating the physiological role of NAD(P)H-quinone oxidoreductase subunit 3 in stress responses requires a multi-faceted approach:
Gene expression analysis:
Quantify ndhC transcript levels under various stress conditions (drought, high light, temperature extremes)
Compare expression patterns across different plant tissues and developmental stages
Use RNA-Seq to identify co-regulated genes that may function in the same pathways
Genetic modification approaches:
Generate knockout or knockdown lines targeting ndhC
Create overexpression lines with native or modified ndhC
Use CRISPR/Cas9 for precise genome editing to introduce specific mutations
Compare phenotypes under both normal and stress conditions
Biochemical characterization:
Measure NAD(P)H oxidation rates in isolated chloroplasts from stressed plants
Quantify redox status and ATP/NADPH ratios in wild-type versus modified plants
Determine the impact of environmental factors on enzyme kinetics parameters
Protein-protein interaction studies:
Identify interaction partners through co-immunoprecipitation or yeast two-hybrid assays
Map the complete NAD(P)H dehydrogenase complex composition under different conditions
Investigate how stress affects complex assembly and stability
These approaches collectively provide a comprehensive understanding of how NAD(P)H-quinone oxidoreductase subunit 3 contributes to plant stress responses through modulating chloroplast energetics.
NAD(P)H-quinone oxidoreductases show significant potential for biotechnological applications:
Bioremediation applications:
Biocatalysis applications:
NAD(P)H-quinone oxidoreductases can be used for stereoselective reduction reactions
Integration into multi-enzyme cascades for complex chemical transformations
Production of high-value quinone derivatives for pharmaceutical applications
Metabolic engineering applications:
Analytical applications:
Development of biosensors for quinone detection in environmental or medical samples
High-throughput screening assays for drug discovery
Real-time monitoring of cellular redox status
Researchers working on structural studies of membrane-associated NAD(P)H-quinone oxidoreductases face several challenges:
Protein purification challenges:
Maintaining native conformation during extraction from membranes
Selecting appropriate detergents that maintain protein stability
Achieving sufficient protein yield without compromising quality
Crystallization difficulties:
Membrane proteins typically have limited hydrophilic surface area for crystal contacts
Lipid/detergent micelles can interfere with crystallization packing
Conformational heterogeneity may hamper crystal formation
Data collection and processing complexities:
Membrane protein crystals often diffract to lower resolution
Anisotropic diffraction patterns require specialized processing
Phase determination may be challenging due to limited isomorphism
Emerging alternative approaches:
Cryo-electron microscopy for structure determination without crystallization
NMR spectroscopy for dynamic studies in membrane-mimicking environments
Computational approaches combining homology modeling with molecular dynamics simulations
These challenges necessitate innovative approaches to elucidate the detailed structural biology of membrane-associated NAD(P)H-quinone oxidoreductases.
While the search results don't provide specific information on post-translational modifications (PTMs) of Illicium oligandrum NAD(P)H-quinone oxidoreductase subunit 3, research on similar enzymes suggests several important considerations:
Types of PTMs potentially affecting function:
Phosphorylation: May regulate catalytic activity through conformational changes
Acetylation: Could affect protein-protein interactions within the complex
Redox modifications: Cysteine residues may form regulatory disulfide bridges
Glycosylation: Rare in chloroplast proteins but may affect stability
Experimental approaches to study PTMs:
Mass spectrometry-based proteomics to identify and quantify modifications
Site-directed mutagenesis of potentially modified residues
Comparative analysis of enzyme activity before and after treatment with modifying enzymes
In vivo labeling techniques to capture dynamic modification patterns
Physiological significance:
PTMs may serve as rapid response mechanisms to changing environmental conditions
Different modifications could create functional diversity from limited genetic resources
Cross-talk between different PTMs might integrate multiple signaling pathways
Understanding these modifications will provide insights into the fine-tuning of NAD(P)H-quinone oxidoreductase activity in response to changing cellular and environmental conditions.