Recombinant Illicium oligandrum NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

What is Illicium oligandrum NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic?

Illicium oligandrum NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic is a protein component of the NAD(P)H dehydrogenase complex located in the chloroplast of Illicium oligandrum (Star anise). The protein is encoded by the ndhE gene in the chloroplast genome and functions in electron transport processes. The full-length protein consists of 101 amino acids with the sequence: MMLEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINLVTFSDLFDSRQLKGDIFSIFVIAIAAAEAAIGPAIVSSIYRNRKSTRINQSNLLNK . This protein is part of the NDH complex that catalyzes the reduction of quinones to hydroquinones using NAD(P)H as an electron donor.

How does this protein compare structurally with homologous proteins in related species?

Comparative genomic analyses have revealed important structural features and positioning of the gene encoding this protein. In chloroplast genome comparisons between Schisandra species and Illicium oligandrum, the ndhE gene shows specific positioning patterns near genomic borders. At the IRA-SSC border, the related ndhF gene shares nucleotides with ycf1 (11 bp in Illicium oligandrum compared to 33 bp in S. sphenanthera and 112 bp in S. chinensis) . The IRB-SSC border in Illicium oligandrum shows the IRB region expanding by 413 bp toward ycf1, which differs from the expansion patterns in other species (1283 bp in S. sphenanthera, 1281 bp in S. chinensis) . These variations suggest species-specific genomic arrangements that may influence the expression and function of chloroplast genes including ndhE.

What are the general characteristics of the recombinant form of this protein?

The recombinant form of this protein has the following characteristics:

The recombinant protein maintains the full amino acid sequence of the native protein while incorporating an N-terminal His-tag for purification purposes .

What are the primary functions of NAD(P)H-quinone oxidoreductases in chloroplasts?

NAD(P)H-quinone oxidoreductases in chloroplasts serve multiple critical functions:

• Electron transport: They participate in cyclic electron flow around photosystem I, contributing to ATP synthesis without concurrent NADPH production.

• Oxidative stress protection: These enzymes catalyze the two-electron reduction of quinones to hydroquinones, bypassing the formation of semiquinone intermediates that would otherwise generate reactive oxygen species (ROS) . This mechanism represents a significant protective function against oxidative damage.

• Redox homeostasis: They help maintain the redox balance in the chloroplast by regulating the ratio of reduced to oxidized electron carriers.

• Stress response: The activity of these enzymes often increases during environmental stresses, suggesting a role in adaptation to challenging conditions.

In Illicium species, which produce various bioactive compounds, these enzymes may also have specialized roles in secondary metabolism related to the plant's unique phytochemical profile .

How does the two-electron reduction mechanism protect against oxidative stress?

The two-electron reduction mechanism of NAD(P)H-quinone oxidoreductases represents a critical cellular defense against oxidative stress through several pathways:

• Prevention of semiquinone formation: By catalyzing the direct two-electron reduction of quinones to hydroquinones, these enzymes bypass the formation of semiquinone intermediates that would be produced by one-electron reduction pathways (such as those catalyzed by cytochrome P450 reductase) .

• Elimination of redox cycling: Semiquinones readily participate in redox cycling with molecular oxygen, generating superoxide radicals and subsequent ROS that damage cellular components. The two-electron reduction eliminates this harmful cycle .

• Detoxification of quinones: Many quinones are themselves reactive electrophiles that can form adducts with proteins and DNA. Their reduction to more stable hydroquinones prevents these damaging interactions.

• Integration with other antioxidant systems: The activity of these enzymes complements other antioxidant mechanisms in the chloroplast, including superoxide dismutase, ascorbate peroxidase, and glutathione systems.

This protective mechanism is particularly important in photosynthetic tissues where electron transport processes can generate significant oxidative stress under fluctuating light conditions .

What protein-protein interactions are known to involve NAD(P)H-quinone oxidoreductases?

NAD(P)H-quinone oxidoreductases engage in various protein-protein interactions that regulate their function and integration into cellular processes:

• Complex assembly interactions: In chloroplasts, the ndhE subunit interacts with other components of the NDH complex to form a functional electron transport assembly embedded in the thylakoid membrane.

• Regulatory interactions: NAD(P)H-quinone oxidoreductases are known to interact with regulatory proteins that modulate their activity in response to cellular needs and environmental conditions.

• Stabilizing interactions: Similar to what has been observed with related enzymes like NQO1, these proteins may interact with various cellular proteins to protect them from proteasomal degradation. NQO1, for example, has been shown to stabilize proteins such as p53, p63, p73, and PGC1α in an NAD(P)H-dependent manner .

• Metabolic channeling partnerships: These enzymes often form associations with metabolic partners to facilitate the direct transfer of electron equivalents or reaction products, improving the efficiency of electron transport chains.

Research on similar oxidoreductase complexes has demonstrated that these interactions are often dynamic and responsive to cellular redox status, allowing for adaptive regulation of electron transport and protective functions .

What are the optimal conditions for expressing recombinant Illicium oligandrum NAD(P)H-quinone oxidoreductase in prokaryotic systems?

Based on established protocols for similar recombinant proteins, the optimal conditions for expressing Illicium oligandrum NAD(P)H-quinone oxidoreductase in prokaryotic systems include:

• Expression system selection:

  • E. coli BL21(DE3) or Rosetta strains are preferred for chloroplastic proteins

  • Cold-adapted strains may improve folding of plant proteins

  • Consider codon optimization for the E. coli expression system

• Vector design considerations:

  • pET series vectors with T7 promoter for high-level expression

  • Inclusion of an N-terminal His-tag for purification

  • Potential inclusion of solubility-enhancing tags (MBP, SUMO, etc.)

  • Incorporation of thrombin or TEV protease sites for tag removal

• Culture conditions:

  • Initial growth at 37°C to OD600 of 0.6-0.8

  • Temperature reduction to 16-25°C prior to induction

  • IPTG induction at 0.1-0.5 mM concentration

  • Extended expression period (16-24 hours) at lower temperature

• Harvest and lysis:

  • Cell collection by centrifugation (5,000 g, 10 minutes)

  • Resuspension in appropriate buffer with protease inhibitors

  • Lysis via sonication or cell disruption systems

  • Clarification by high-speed centrifugation (20,000 g, 30 minutes)

For membrane-associated proteins like NAD(P)H-quinone oxidoreductase, the addition of mild detergents during lysis and purification steps may be necessary to maintain protein solubility and activity .

What methods are most effective for assessing the activity of NAD(P)H-quinone oxidoreductase enzymes?

Several robust methods can be employed to assess the activity of NAD(P)H-quinone oxidoreductase enzymes:

• Spectrophotometric assays:

  • Monitoring NAD(P)H oxidation at 340 nm (ε = 6,220 M⁻¹cm⁻¹)

  • Following the reduction of artificial electron acceptors:

    • Dichlorophenolindophenol (DCPIP) at 600 nm

    • Ferricyanide at 420 nm

    • Cytochrome c at 550 nm

• Enzyme kinetics analysis:

  • Determination of Km and Vmax for NAD(P)H and quinone substrates

  • Investigation of inhibition patterns with known inhibitors

  • pH and temperature optima determination

• ROS formation assessment:

  • Measurement of superoxide production using nitroblue tetrazolium

  • Detection of hydrogen peroxide using Amplex Red/horseradish peroxidase

  • Comparing ROS generation with and without the enzyme during quinone metabolism

• Reconstitution assays:

  • Incorporation into liposomes or nanodiscs for membrane proteins

  • Measurement of electron transfer in reconstituted systems

  • Assessment of protective effects against quinone-induced oxidative damage

These methods can be adapted based on specific research questions, substrate availability, and the particular properties of the Illicium oligandrum enzyme .

What purification strategies yield the highest activity retention for recombinant NAD(P)H-quinone oxidoreductases?

Purification strategies that maximize activity retention for recombinant NAD(P)H-quinone oxidoreductases typically involve:

• Initial capture using affinity chromatography:

  • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

  • Gentle elution with imidazole gradient rather than step elution

  • Immediate buffer exchange to remove imidazole

• Buffer optimization:

  • Inclusion of 10-20% glycerol as a stabilizer

  • Addition of reducing agents (1-5 mM DTT or β-mercaptoethanol)

  • Maintenance of physiological pH (typically 7.0-8.0)

  • Inclusion of appropriate cofactors (NAD(P)H, FAD, or FMN)

• Secondary purification:

  • Ion exchange chromatography at controlled pH

  • Size exclusion chromatography for oligomeric state assessment

  • Hydrophobic interaction chromatography when appropriate

• Critical handling considerations:

  • Maintaining low temperature (4°C) throughout purification

  • Minimizing exposure to light for flavin-containing enzymes

  • Avoiding freeze-thaw cycles by appropriate aliquoting

  • Conducting activity assays at each purification stage

• Storage conditions:

  • Addition of 5-50% glycerol for freezing stability

  • Storage at -80°C in small aliquots

  • Optional lyophilization with cryoprotectants for long-term storage

For membrane-associated NAD(P)H-quinone oxidoreductases, the careful selection of detergents that maintain enzymatic function is critical, with mild non-ionic detergents like DDM or LMNG often providing the best results .

How can recombinant Illicium oligandrum NAD(P)H-quinone oxidoreductase be used to study evolutionarily conserved electron transport mechanisms?

Recombinant Illicium oligandrum NAD(P)H-quinone oxidoreductase provides a valuable tool for investigating evolutionarily conserved electron transport mechanisms through several research approaches:

• Comparative biochemical analysis:

  • Side-by-side activity assays with homologous enzymes from phylogenetically diverse species

  • Identification of conserved kinetic parameters across evolutionary distances

  • Characterization of substrate specificity shifts related to adaptation

• Structure-function relationship studies:

  • Site-directed mutagenesis of conserved residues identified through sequence alignment

  • Creation of chimeric proteins with domains from different species

  • Crystallographic or cryo-EM structural studies to identify conserved catalytic architectures

• Evolutionary trajectory reconstruction:

  • Ancestral sequence reconstruction and expression of predicted ancestral enzymes

  • Measurement of selective pressures on different protein domains

  • Analysis of chloroplast genome arrangement across the Illiciales order and related taxa

• Functional complementation experiments:

  • Expression in model organisms with knockout mutations in homologous genes

  • Assessment of cross-species functional conservation

  • Identification of species-specific adaptations in electron transport mechanisms

• Systems biology integration:

  • Reconstruction of electron transport networks across species

  • Prediction of conserved regulatory mechanisms

  • Identification of convergent evolutionary solutions to redox challenges

These approaches can provide insights into both the fundamental conservation of electron transport mechanisms across plant evolution and the specific adaptations that have occurred in the Illicium lineage .

What insights can this protein provide about chloroplast genome evolution in Illicium species?

The study of NAD(P)H-quinone oxidoreductase subunit 4L provides several important insights into chloroplast genome evolution in Illicium species:

• IR border dynamics:

  • The positioning of ndhE and related genes near IR-SSC borders reveals evolutionary patterns of chloroplast genome rearrangements

  • In Illicium oligandrum, the IRB region expands 413 bp toward ycf1, which differs significantly from the expansion patterns in related species

  • These variations indicate lineage-specific genomic restructuring events

• Gene conservation patterns:

  • The maintenance of ndhE in the Illicium chloroplast genome suggests selective pressure to preserve this function

  • Comparative analysis with other species reveals the evolutionary trajectory of the NDH complex genes

  • Sequence conservation analysis can identify functionally critical domains maintained through evolution

• Taxonomic implications:

  • The specific arrangement of ndhE and surrounding genes can serve as molecular markers for Illicium classification

  • Comparison with other medicinal plants in the Schisandraceae family provides insights into evolutionary relationships

  • These genomic features can help resolve phylogenetic relationships within the early-diverging angiosperms

• Selection pressure analysis:

  • The ratio of synonymous to non-synonymous substitutions in ndhE across species reflects the type and strength of selection

  • Regions of high conservation likely indicate functional constraints

  • Variation hotspots may represent adaptations to different environmental conditions

This research contributes to our understanding of both chloroplast genome evolution in ancient angiosperm lineages and the molecular basis of the medicinal properties of Illicium species .

How does this protein contribute to the photosynthetic efficiency of Illicium oligandrum?

The NAD(P)H-quinone oxidoreductase subunit 4L contributes to photosynthetic efficiency in Illicium oligandrum through several mechanisms:

• Cyclic electron flow enhancement:

  • As part of the NDH complex, it facilitates cyclic electron transport around photosystem I

  • This process generates additional ATP without producing NADPH

  • The resulting balanced ATP:NADPH ratio optimizes carbon fixation efficiency

  • This is particularly important under fluctuating light conditions or environmental stress

• Photoprotection mechanisms:

  • The enzyme helps dissipate excess excitation energy during high light conditions

  • By maintaining redox balance, it prevents over-reduction of the electron transport chain

  • This reduces photoinhibition and protects photosynthetic apparatus from damage

  • The protective function is especially relevant in the understory forest habitat of Illicium oligandrum

• Oxidative stress management:

  • Through its two-electron reduction mechanism, it prevents the formation of reactive oxygen species

  • This protection extends the functional lifespan of photosynthetic components

  • The enzyme helps maintain the redox status of the chloroplast stroma

  • These functions preserve photosynthetic capacity under environmental challenges

• Metabolic integration:

  • The enzyme's activity is coordinated with carbon fixation pathways

  • It responds to changes in metabolic demand for ATP and reducing power

  • This coordination optimizes resource allocation during different growth phases

  • The integration extends to specialized metabolism pathways unique to Illicium species

These contributions to photosynthetic efficiency may be particularly important for Illicium oligandrum, which must adapt to the specific light conditions of its native habitat while supporting the production of energetically costly specialized metabolites .

What are the challenges in structural characterization of membrane-associated chloroplastic proteins like NAD(P)H-quinone oxidoreductase?

Structural characterization of membrane-associated chloroplastic proteins like NAD(P)H-quinone oxidoreductase presents several significant challenges:

• Protein extraction and purification obstacles:

  • Maintaining native membrane environment during solubilization

  • Selecting detergents that preserve structure without disrupting function

  • Preventing aggregation during concentration and crystallization attempts

  • Achieving sufficient purity while retaining protein-protein interactions

• Technical limitations in structural biology:

  • Difficulty in growing high-quality crystals of membrane proteins

  • Lower resolution typically achieved for membrane protein structures

  • Challenges in phase determination for novel structures

  • Potential artifacts introduced by detergent micelles

• Conformational dynamics complexities:

  • Capturing functionally relevant conformational states

  • Resolving flexible regions that may be crucial for function

  • Determining the influence of lipid environment on protein conformation

  • Understanding oligomerization states in membrane context

• Specialized methodological requirements:

  • Need for lipid nanodiscs or reconstitution into liposomes

  • Cryo-electron microscopy sample preparation challenges

  • Specialized NMR techniques for membrane protein studies

  • Computational challenges in molecular dynamics simulations

• Post-translational modification analysis:

  • Maintaining modifications during purification

  • Identifying tissue-specific or condition-dependent modifications

  • Determining the structural impact of these modifications

  • Correlating modification patterns with functional states

Addressing these challenges requires integrated approaches combining advanced membrane protein biochemistry, structural biology technologies, and computational modeling to obtain meaningful structural insights into the function of these complex proteins .

What spectroscopic methods are most informative for analyzing the redox properties of NAD(P)H-quinone oxidoreductases?

Several advanced spectroscopic methods provide crucial insights into the redox properties of NAD(P)H-quinone oxidoreductases:

• UV-Visible absorption spectroscopy:

  • Monitoring flavin cofactor redox state transitions at 450-500 nm

  • Following NAD(P)H oxidation at 340 nm

  • Tracking quinone reduction through specific absorption bands

  • Time-resolved measurements for reaction kinetics determination

• Fluorescence spectroscopy:

  • Intrinsic fluorescence of enzyme-bound flavins (excitation ~450 nm, emission ~525 nm)

  • NADH fluorescence (excitation ~340 nm, emission ~460 nm)

  • Fluorescence quenching studies to probe cofactor binding sites

  • FRET-based approaches for studying conformational changes during catalysis

• Electron paramagnetic resonance (EPR):

  • Detection of semiquinone radical intermediates

  • Characterization of metal centers in the enzyme complex

  • Spin-trapping of reactive oxygen species generated during catalysis

  • Double electron-electron resonance for measuring distances between redox centers

• Resonance Raman spectroscopy:

  • Vibrational characterization of flavin cofactors

  • Identification of quinone binding conformations

  • Investigation of electron-nuclear coupling

  • Monitoring structural changes during redox cycling

• Protein film voltammetry:

  • Direct measurement of redox potentials

  • Analysis of electron transfer kinetics

  • Investigation of pH dependence of redox properties

  • Assessment of substrate binding effects on electron transfer

• Circular dichroism spectroscopy:

  • Near-UV CD for monitoring tertiary structure changes

  • Visible CD for characterizing flavin binding environment

  • Thermal stability studies in different redox states

  • Induced CD to analyze cofactor-protein interactions

These spectroscopic methods, when used in combination, provide comprehensive insights into the electronic structure, reaction mechanisms, and conformational dynamics associated with the redox functions of NAD(P)H-quinone oxidoreductases .

How can computational approaches enhance our understanding of NAD(P)H-quinone oxidoreductase catalytic mechanisms?

Computational approaches provide powerful tools for elucidating the catalytic mechanisms of NAD(P)H-quinone oxidoreductases:

• Molecular dynamics simulations:

  • Exploration of protein conformational landscapes

  • Investigation of substrate binding and product release pathways

  • Analysis of water and proton transfer networks

  • Examination of protein flexibility and its role in catalysis

• Quantum mechanical calculations:

  • Electronic structure determination of reaction intermediates

  • Calculation of activation energies for electron transfer steps

  • Investigation of transition states during hydride transfer

  • Analysis of flavin electronic properties in the protein environment

• Hybrid QM/MM methods:

  • Integrating quantum treatment of reaction center with molecular mechanical approach for protein environment

  • Calculation of reaction profiles including protein environmental effects

  • Identification of catalytically important residues

  • Prediction of effects of site-directed mutations

• Homology modeling and structure prediction:

  • Construction of structural models based on related proteins

  • Prediction of substrate binding modes

  • Identification of conserved catalytic motifs

  • Virtual screening for potential inhibitors or activators

• Machine learning applications:

  • Pattern recognition in sequence-structure-function relationships

  • Prediction of functional effects of genetic variations

  • Integration of diverse experimental data sets

  • Acceleration of molecular dynamics sampling

• Network analysis:

  • Identification of allosteric communication pathways

  • Analysis of evolutionary couplings between residues

  • Prediction of protein-protein interaction interfaces

  • Integration with systems biology models of electron transport

These computational approaches, validated by experimental data, can provide atomic-level insights into catalytic mechanisms that would be difficult or impossible to obtain through experiments alone, advancing our fundamental understanding of these important enzymes .

How might studying Illicium oligandrum NAD(P)H-quinone oxidoreductase contribute to understanding plant adaptation to environmental stresses?

Studying Illicium oligandrum NAD(P)H-quinone oxidoreductase offers several avenues for understanding plant adaptation to environmental stresses:

• Redox homeostasis in stress conditions:

  • Characterization of enzyme activity under various stress conditions (drought, high light, temperature extremes)

  • Comparison with homologous enzymes from plants adapted to different environments

  • Investigation of post-translational modifications induced by stress

  • Analysis of how the enzyme contributes to maintaining cellular redox balance under stress

• Evolutionary adaptations in ancient angiosperms:

  • Illicium represents an early-diverging angiosperm lineage, providing insights into ancient adaptive mechanisms

  • Comparative analysis of the enzyme across species with different ecological niches

  • Identification of unique structural or functional features that confer stress tolerance

  • Reconstruction of ancestral sequences to understand the evolution of stress responses

• Integration with specialized metabolism:

  • Exploration of links between electron transport and production of stress-protective compounds

  • Investigation of how the enzyme supports the energetic requirements of specialized metabolism

  • Analysis of coordinated regulation between primary and secondary metabolism under stress

  • Correlation between NAD(P)H-quinone oxidoreductase activity and accumulation of bioactive compounds

• Signaling network participation:

  • Examination of the enzyme's role in chloroplast-to-nucleus retrograde signaling

  • Investigation of potential protein-protein interactions with stress signaling components

  • Analysis of how redox changes mediated by the enzyme trigger broader cellular responses

  • Identification of transcriptional networks influenced by the enzyme's activity

This research could reveal novel mechanisms of stress adaptation that evolved early in flowering plant history and have been preserved in Illicium species, potentially providing insights applicable to improving crop stress resilience .

What are the methodological challenges in studying protein-protein interactions involving chloroplastic membrane proteins?

Studying protein-protein interactions involving chloroplastic membrane proteins like NAD(P)H-quinone oxidoreductase presents several methodological challenges:

• Native environment preservation:

  • Maintaining the lipid environment crucial for proper protein conformation

  • Selecting detergents that solubilize without disrupting protein complexes

  • Balancing solubilization efficiency with preservation of native interactions

  • Developing membrane mimetics that recapitulate the chloroplast membrane properties

• Technical limitations of conventional methods:

  • Co-immunoprecipitation complications due to hydrophobicity

  • Yeast two-hybrid incompatibility with membrane proteins

  • Fluorescence-based assays affected by chlorophyll interference

  • Mass spectrometry challenges in identifying hydrophobic peptides

• Distinguishing specific from non-specific interactions:

  • High background of hydrophobic interactions in membrane environments

  • Difficulty in establishing appropriate negative controls

  • Concentration-dependent aggregation confounding interaction studies

  • Transient interactions that may be lost during analysis

• Reconstitution complexities:

  • Recreating multiprotein complexes with correct stoichiometry

  • Incorporation of correct lipid compositions for functional assembly

  • Expression and purification of multiple interaction partners

  • Verification of proper protein orientation in artificial membrane systems

• Advanced technique adaptations:

  • Modified crosslinking approaches for membrane proteins

  • Specialized proximity labeling methods for chloroplast environments

  • Adapted split-fluorescent protein systems for chloroplast targeting

  • Native mass spectrometry protocols for membrane protein complexes

Addressing these challenges requires integrated approaches that combine advances in membrane protein biochemistry, structural biology, and in vivo imaging techniques specifically adapted for the unique environment of the chloroplast .

How can multi-omics approaches enhance our understanding of the role of NAD(P)H-quinone oxidoreductases in plant metabolism?

Multi-omics approaches offer powerful strategies to decipher the complex roles of NAD(P)H-quinone oxidoreductases in plant metabolism:

• Integrated transcriptomics and proteomics:

  • Correlation of gene expression patterns with protein abundance under different conditions

  • Identification of coordinated regulation of electron transport components

  • Discovery of condition-specific isoforms or splice variants

  • Mapping of transcriptional networks controlling NAD(P)H-quinone oxidoreductase expression

• Metabolomics integration:

  • Profiling metabolite changes associated with altered enzyme activity

  • Tracing metabolic flux through pathways influenced by electron transport

  • Identification of bioactive compounds whose production depends on redox homeostasis

  • Correlation of quinone/hydroquinone ratios with broader metabolic states

• Redox proteomics approaches:

  • Mapping of redox-sensitive protein thiols influenced by NAD(P)H-quinone oxidoreductase activity

  • Identification of post-translational modifications responsive to redox changes

  • Quantification of protein oxidation states under different conditions

  • Analysis of thiol-disulfide exchange networks in chloroplasts

• Functional genomics integration:

  • CRISPR-based editing to create targeted mutations

  • RNAi or antisense approaches for conditional knockdowns

  • Overexpression studies to assess gain-of-function phenotypes

  • Complementation experiments with variants from different species

• Systems biology modeling:

  • Construction of electron flow models incorporating experimental data

  • Prediction of metabolic responses to altered NAD(P)H-quinone oxidoreductase activity

  • Identification of regulatory nodes connecting electron transport to other pathways

  • Simulation of evolutionary trajectories based on comparative genomics data

These multi-omics approaches, when applied to Illicium oligandrum and related species, can provide comprehensive insights into how NAD(P)H-quinone oxidoreductases coordinate electron transport with specialized metabolism, stress responses, and developmental processes in these medicinally important plants .