Recombinant Illicium oligandrum NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic

What is Recombinant Illicium oligandrum NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic?

Recombinant Illicium oligandrum NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic is a protein component of the chloroplastic electron transport chain derived from Illicium oligandrum (star anise). This protein is also known by alternative names including NAD(P)H dehydrogenase subunit 6 and NADH-plastoquinone oxidoreductase subunit 6, with the gene designation ndhG. The protein has a UniProt accession number A6MMZ8 and belongs to the enzyme class EC 1.6.5.-, which encompasses NAD(P)H dehydrogenases . The full-length protein consists of 177 amino acids with a sequence that includes multiple transmembrane domains, suggesting its integration into chloroplastic membranes where it participates in electron transfer processes .

What is the structural composition of this protein?

The protein consists of 177 amino acids with the complete sequence: MDLPGPIHDIFLVFLGSGLILGGLGVVLLTNPVYSAFSLGLVLVCISLFHIPSNSYFVAAAQLLIYVGAINVLIVFAVMFMNGSEYYNYFHLWTVGDGVTSLICTSILFSLIKTILDTSWYGIIWTRSNQIIEQDLISNVQQIGIHLSTDFYLPFELISIILLVALVGAIAMARQE . Structural analysis indicates this is a membrane-associated protein with multiple transmembrane helices, consistent with its role in the chloroplastic electron transport chain. While the tertiary structure has not been fully determined for the Illicium oligandrum version specifically, related bacterial complex I structures (such as from E. coli) demonstrate an L-shaped conformation in both lipid bilayers and solution . This conformation is likely conserved in the chloroplastic NDH complex, though with plant-specific modifications to accommodate the unique environment of the chloroplast.

How does this protein function within chloroplastic electron transport chains?

NAD(P)H-quinone oxidoreductase subunit 6 functions as part of the larger NDH complex in chloroplasts, where it participates in cyclic electron flow around photosystem I. The protein specifically contributes to the proton-pumping machinery that helps generate and maintain the proton gradient necessary for ATP synthesis. As part of the NDH complex, it catalyzes the transfer of electrons from NADH or NADPH to plastoquinone, coupled with proton translocation across the thylakoid membrane. Similar to bacterial complex I (NDH-1), the structure is stabilized by lipids and divalent cations, which are essential for maintaining proper conformation and function . The L-shaped structure observed in bacterial homologs is thought to be critical for the coupling of electron transfer to proton pumping, with the membrane domain (where subunit 6 is located) forming part of the proton translocation pathway.

What are the optimal storage conditions for this recombinant protein?

For optimal storage of Recombinant Illicium oligandrum NAD(P)H-quinone oxidoreductase subunit 6, store the protein at -20°C for regular use, or at -80°C for extended storage periods . The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized for stability . To maintain protein integrity, avoid repeated freeze-thaw cycles as these can lead to protein denaturation and loss of activity. Instead, prepare working aliquots that can be stored at 4°C for up to one week . When reconstituting lyophilized protein preparations, use deionized sterile water to reach a concentration of 0.1-1.0 mg/mL, and consider adding glycerol to a final concentration of 5-50% before aliquoting to enhance stability . Always briefly centrifuge vials prior to opening to bring contents to the bottom and minimize protein loss.

How can I optimize activity assays for NAD(P)H-quinone oxidoreductase?

To optimize activity assays for NAD(P)H-quinone oxidoreductase, consider the following methodological approach: Begin by establishing a stable buffer system that mimics physiological conditions while supporting enzyme stability—typically a Tris-based buffer with pH 7.5-8.0. Add divalent cations (typically Mg²⁺ or Mn²⁺) and native lipids to the assay medium, as these have been shown to effectively stabilize complex I and fully restore ubiquinone reductase activity . Monitor the oxidation of NADH or NADPH spectrophotometrically at 340 nm while providing an appropriate quinone acceptor substrate. For quantitative assessment of activity, establish a standard curve using known concentrations of active enzyme under identical conditions. Control experiments should include assays with specific inhibitors like diphenylene iodonium (DPI) to confirm the specificity of the observed activity . Variation in temperature, pH, and substrate concentration will help determine optimal assay conditions and kinetic parameters.

What techniques are recommended for structural studies of this protein?

For structural studies of NAD(P)H-quinone oxidoreductase subunit 6, employ a multi-technique approach that addresses the challenges of membrane protein analysis. Begin with protein purification using an improved procedure that includes divalent cations and lipids for stabilization . Two-dimensional crystallization has been successfully employed with related proteins by using lipids containing native extracts, resulting in crystals with p2 and p3 symmetry that maintain the protein's L-shaped conformation . Single-particle cryo-electron microscopy represents another powerful approach, especially when combined with activity assays to correlate structure with function. For higher-resolution structural information, X-ray crystallography requires additional stabilization strategies, potentially including the use of antibody fragments or nanobodies to facilitate crystal contacts. Native mass spectrometry and hydrogen-deuterium exchange mass spectrometry can provide complementary information about subunit interactions and conformational dynamics, respectively.

How can this protein be used in studies of chloroplastic electron transport chains?

This recombinant protein can serve as a valuable tool for investigating chloroplastic electron transport chains through multiple experimental approaches. Researchers can use the purified protein to reconstitute NDH complex activity in artificial membrane systems, allowing for controlled studies of electron transfer rates and mechanisms. The protein can be employed in binding studies to identify interaction partners within the chloroplastic NDH complex, helping to elucidate the full architecture of this important multiprotein assembly. Comparative analysis between the recombinant protein and native complexes can reveal post-translational modifications or cofactor requirements that influence activity in vivo. Additionally, the protein can be used to generate specific antibodies for immunolocalization studies to determine the precise distribution of the NDH complex within chloroplast membranes. These approaches collectively contribute to our understanding of how plants optimize electron flow for efficient photosynthesis under varying environmental conditions.

What role does this protein play in investigating oxidative stress mechanisms?

This protein can serve as an important tool for investigating oxidative stress mechanisms in plants. As part of the NAD(P)H oxidoreductase complex, it is involved in electron transport processes that can potentially generate reactive oxygen species (ROS) under certain conditions, similar to how NADPH oxidase produces ROS in other systems . Researchers can use this recombinant protein to study how alterations in electron transport chain components affect ROS production in chloroplasts. By reconstituting the protein into membrane systems and modulating electron flow, researchers can measure ROS generation and identify conditions that trigger oxidative stress. The protein can also be used to develop inhibitor screens targeting specific steps in electron transport, potentially identifying compounds that modulate ROS production. Such studies contribute to our understanding of how plants respond to environmental stresses that disrupt photosynthetic electron flow and lead to oxidative damage.

How can comparative studies with this protein inform evolutionary biology?

Comparative studies using Recombinant Illicium oligandrum NAD(P)H-quinone oxidoreductase subunit 6 can provide valuable insights into evolutionary biology through several methodological approaches. Researchers can align the amino acid sequence with homologous proteins from diverse plant lineages to identify conserved domains that reflect functional constraints across evolutionary time. The protein can be used in functional complementation studies, where it is expressed in mutant organisms lacking the endogenous protein, to determine functional conservation across species. Structural comparisons between this chloroplastic protein and its bacterial homologs can illuminate the evolutionary transition from endosymbiotic bacteria to modern chloroplasts. Additionally, comparing kinetic parameters of the recombinant protein with those from other plant species can reveal adaptive changes in electron transport mechanisms. These comparative approaches provide evidence for evolutionary processes such as intergenic transfer (IGT), as observed in studies of genome interactions , contributing to our understanding of organellar genome evolution.

How should researchers interpret activity data for this oxidoreductase in different experimental contexts?

When interpreting activity data for NAD(P)H-quinone oxidoreductase across different experimental contexts, researchers should implement a systematic analytical framework. First, normalize activity measurements to protein concentration using appropriate standards to enable valid cross-experiment comparisons. Consider the lipid environment's critical influence, as native E. coli lipids have been demonstrated to fully restore ubiquinone reductase activity in purified complex I . Evaluate enzyme stability over time under your experimental conditions, as membrane proteins often show activity decay that must be accounted for in longer experiments. When comparing activity across different pH, temperature, or ionic strength conditions, construct three-dimensional activity landscapes rather than simple pairwise comparisons to identify optimal conditions and potential synergistic effects. For kinetic parameters, use multiple plotting methods (Lineweaver-Burk, Eadie-Hofstee, and Hanes-Woolf) to verify consistency and identify potential allosteric behaviors. Finally, when comparing your recombinant protein to native enzyme preparations, consider that post-translational modifications present in vivo may be absent in recombinant systems, potentially altering activity profiles.

What statistical approaches are most appropriate for analyzing structural data related to this protein?

When analyzing structural data for NAD(P)H-quinone oxidoreductase subunit 6, employ statistical approaches that account for the unique challenges of membrane protein structural biology. For two-dimensional crystal analysis, apply Fourier transform and correlation averaging techniques with appropriate symmetry constraints (p2 and p3 symmetry have been observed in related complexes) . When analyzing electron microscopy data, implement maximum likelihood classification methods to sort heterogeneous particle populations that may represent different conformational states. For structural comparisons across species or experimental conditions, use distance matrix analysis rather than simple RMSD calculations to better capture local structural variations in specific functional domains. When integrating data from multiple structural techniques (X-ray crystallography, cryo-EM, spectroscopy), employ Bayesian statistical frameworks to optimally weight each data source according to its reliability and resolution. For molecular dynamics simulations examining protein-lipid interactions, analyze residence times and enrichment factors of specific lipid types around the protein using time-correlation functions to identify specific lipid binding sites that may be functionally relevant.

How can researchers differentiate between experimental artifacts and genuine protein characteristics?

To differentiate between experimental artifacts and genuine protein characteristics when working with NAD(P)H-quinone oxidoreductase subunit 6, implement a multi-faceted validation strategy. First, perform parallel experiments using different expression systems and purification protocols to verify that observed properties persist across preparation methods. Conduct activity assays in the presence and absence of native lipids, as these have been shown to restore full activity in related complexes , helping distinguish between intrinsic protein properties and artifacts from lipid depletion. Employ complementary structural techniques (e.g., circular dichroism, infrared spectroscopy, and limited proteolysis) to confirm that the recombinant protein adopts the expected secondary and tertiary structure. When analyzing membrane insertion and topology, compare results from computational predictions with experimental approaches such as protease accessibility and reporter fusion assays to establish consensus. For functional studies, use multiple substrate analogs and inhibitors with varying chemical properties to distinguish genuine catalytic properties from non-specific effects. Finally, systematically vary buffer conditions, temperature, and protein concentration to identify parameters that induce artifactual behavior versus those where the protein exhibits consistent characteristics.

How does the interaction between this protein and lipids affect its function and structure?

The interaction between NAD(P)H-quinone oxidoreductase subunit 6 and membrane lipids represents a critical determinant of both function and structure. Research with bacterial complex I (a homologous system) demonstrates that native lipids play multiple roles: they fully restore ubiquinone reductase activity, effectively stabilize the complex, and facilitate crystallization . Methodologically, researchers should investigate these interactions through a multi-technique approach. Lipid reconstitution experiments comparing different lipid compositions can reveal lipid class specificity for functional restoration. Native mass spectrometry can identify specific lipids that remain bound through purification, suggesting high-affinity interactions essential for stability. Molecular dynamics simulations can map the distribution of lipids around the protein and identify potential binding sites. Hydrogen-deuterium exchange mass spectrometry before and after lipid addition can reveal conformational changes induced by lipid binding. These approaches collectively illuminate how the lipid environment modulates protein structure and function, which is particularly relevant for chloroplastic proteins that function in the specialized lipid environment of thylakoid membranes.

What are the methodological challenges in studying the integration of this protein into multi-subunit complexes?

Studying the integration of NAD(P)H-quinone oxidoreductase subunit 6 into multi-subunit complexes presents several methodological challenges requiring sophisticated experimental approaches. First, researchers must develop co-expression systems that ensure proper stoichiometry of all subunits, potentially using polycistronic constructs or multiple compatible vectors with differential promoter strengths. Assembly intermediates should be tracked using pulse-chase experiments combined with blue native gel electrophoresis to establish the temporal sequence of subunit incorporation. For interaction mapping, chemical cross-linking followed by mass spectrometry can identify contact points between subunits, while site-directed mutagenesis of predicted interface residues can validate these interactions functionally. Single-molecule fluorescence techniques like FRET can monitor assembly dynamics in real-time when critical subunits are fluorescently labeled. For structural analysis of the assembled complex, cryo-electron microscopy with focused classification algorithms can resolve heterogeneity resulting from incomplete assembly or alternative conformations. These methodological approaches collectively address the challenges of studying multi-step assembly processes involving membrane proteins like NAD(P)H-quinone oxidoreductase subunit 6.

How can researchers investigate potential post-translational modifications of this protein?

To comprehensively investigate post-translational modifications (PTMs) of NAD(P)H-quinone oxidoreductase subunit 6, researchers should implement a multi-faceted mass spectrometry-based workflow. Begin with parallel analysis of the recombinant protein and the native protein isolated from Illicium oligandrum chloroplasts to identify modifications present in vivo but absent in recombinant systems. Employ complementary fragmentation techniques (CID, ETD, and HCD) to maximize PTM identification and site localization confidence. Enrich for specific modification types using antibody-based approaches (for phosphorylation, acetylation) or chemical methods (TiO2 for phosphopeptides, hydroxyacid-modified metal oxide chromatography for glycopeptides). For quantitative analysis of modification stoichiometry, use stable isotope labeling or label-free approaches combined with targeted mass spectrometry methods like parallel reaction monitoring. To connect PTMs with functional changes, perform site-directed mutagenesis of modified residues to mimic or prevent modification (e.g., phosphomimetic substitutions) followed by activity assays. Finally, investigate the temporal dynamics of modifications using pulse-chase labeling combined with quantitative proteomics to understand how PTMs regulate protein function throughout its lifecycle.

What insights can be gained from comparing chloroplastic and mitochondrial quinone oxidoreductases?

Comparing chloroplastic NAD(P)H-quinone oxidoreductase subunit 6 with its mitochondrial counterparts provides valuable insights into convergent and divergent evolution of electron transport systems within different organelles. Methodologically, researchers should first perform comprehensive sequence and structural alignments to identify conserved domains and organelle-specific features. Functional studies comparing the recombinant proteins from both organelles can reveal differences in electron donor specificity (NADH versus NADPH preference), quinone acceptor affinity, and coupling efficiency. Inhibitor profiling using organelle-specific inhibitors can highlight structural differences in the active sites. Investigation of protein-lipid interactions is particularly informative, as the lipid compositions of chloroplast and mitochondrial membranes differ significantly, potentially necessitating adaptation of membrane-spanning domains. Evolutionary analysis should consider the endosymbiotic origins of both organelles, examining how these homologous proteins have adapted to their specific organellar environments. This comparative approach can also identify instances of intergenic transfer (IGT) between organellar genomes, as has been observed in studies of genome interactions and evolution , providing evidence for the ongoing evolutionary dialogue between different cellular compartments.