Recombinant Illicium oligandrum Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

The PSII D1 protein serves as the primary site for photooxidative damage and repair during photosynthesis. Key findings from mutagenesis studies in Chlamydomonas reinhardtii highlight its role:

  • Q(B) Binding: Residues in the stromal loop (e.g., Ala251) directly influence quinone affinity. Substitutions with bulky residues (e.g., Ile, Val, Leu) increase the dissociation constant for Q(B), impairing electron transfer .

  • D1 Protein Turnover: Mutations at conserved positions alter D1 synthesis and degradation rates. For example, Leu substitutions at Ala251 reduce photoautotrophic growth but maintain oxygen evolution rates, indicating uncoupling of electron transfer and D1 turnover .

Table 2 summarizes the impact of Ala251 substitutions on PSII function:

SubstitutionEffect on Q(B) BindingD1 TurnoverPhotoautotrophic Growth
CysReduced affinityElevated synthesis/degradationWild-type rates
Ser/Pro/GlyModerate reductionReduced in high lightUnaffected
Ile/Val/LeuSignificant reductionElevated ratesImpaired

Research Applications

The recombinant Illicium oligandrum PSQ(B) protein is used in:

  • Structural Studies: Investigations into quinone-binding motifs and conformational dynamics.

  • Mutagenesis Experiments: Probing the role of conserved residues in electron transfer and protein stability .

  • Biotechnology: Development of models for herbicide resistance and photosynthetic efficiency optimization .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Illicium oligandrum (Star anise)
Target Names
psbA
Target Protein Sequence
MTVILERRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) functions as a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, producing O₂ and a proton gradient essential for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, and several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Recombinant Illicium oligandrum Photosystem Q (B) protein and what are its primary functions?

The Recombinant Illicium oligandrum Photosystem Q (B) protein, also known as Photosystem II protein D1 or 32 kDa thylakoid membrane protein (UniProt ID: A6MMS4), is a critical component of the photosynthetic apparatus . It functions as an integral membrane protein within Photosystem II, facilitating electron transport during the light reactions of photosynthesis with an enzyme classification of EC 1.10.3.9 . The protein is involved in binding plastoquinone at the QB site, which accepts electrons from QA and is crucial for the electron transport chain in photosynthesis .

What expression systems are typically used for producing this recombinant protein?

The Recombinant Illicium oligandrum Photosystem Q (B) protein is primarily expressed in prokaryotic systems, with E. coli being the predominant expression host . This approach allows for the production of the full-length protein (amino acids 1-344) with various tagging options, most commonly N-terminal His-tags to facilitate purification . When designing expression constructs, researchers should consider codon optimization for the chosen expression system to maximize protein yield and proper folding .

What are the recommended storage conditions for maintaining protein stability?

For optimal stability and activity preservation, the following protocol is recommended:

Storage PeriodTemperatureBuffer CompositionAdditional Recommendations
Short-term (<1 week)4°CTris-based buffer, 50% glycerolWorking aliquots only
Medium-term-20°CTris-based buffer, 50% glycerolAvoid freeze-thaw cycles
Long-term-80°CTris-based buffer, 50% glycerolAliquot before freezing

Repeated freeze-thaw cycles should be strictly avoided as they significantly compromise protein integrity and function . When reconstituting lyophilized protein, it is recommended to use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, followed by the addition of glycerol (5-50% final concentration) .

How can the protein structure-function relationship be investigated through site-directed mutagenesis approaches?

Site-directed mutagenesis of the Recombinant Illicium oligandrum Photosystem Q (B) protein can provide valuable insights into structure-function relationships, particularly regarding electron transport efficiency. Based on research conducted on related Photosystem II proteins, strategic modifications to the QB binding pocket can significantly alter electron transfer kinetics .

Methodological approach:

  • Identify conserved amino acid residues within the QB binding pocket through multiple sequence alignment with homologous proteins

  • Design mutagenesis primers targeting these residues, particularly those involved in quinone binding

  • Generate single and combined mutations using overlap extension PCR

  • Express mutant proteins in E. coli using the protocols established for the wild-type protein

  • Evaluate functional changes through electron transfer assays and chronoamperometry measurements

Research on related systems has demonstrated that modifying the environment of the Q binding sites can increase reduction rates of electron mediators, suggesting potential applications in bioenergy research and synthetic biology .

What methodological approaches can be used to study the interaction between Photosystem Q (B) protein and its electron transport partners?

Investigating protein-protein and protein-cofactor interactions within the photosynthetic electron transport chain requires a multi-technique approach:

  • Co-immunoprecipitation (Co-IP):

    • Utilize recombinant tagged versions of the Photosystem Q (B) protein to pull down interacting partners

    • Analyze the resulting complexes using mass spectrometry to identify components

  • Surface Plasmon Resonance (SPR):

    • Immobilize the purified Recombinant Illicium oligandrum Photosystem Q (B) protein on a sensor chip

    • Measure binding kinetics with plastoquinone and other potential electron transport partners

    • Determine association and dissociation rate constants

  • Förster Resonance Energy Transfer (FRET):

    • Generate fluorescently labeled versions of the protein and potential interacting partners

    • Monitor energy transfer efficiency as a measure of protein-protein proximity

    • This technique has been successfully used with other photosystem proteins to map the topology of protein complexes

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Track the formation and decay of radical intermediates during electron transport

    • Identify the specific amino acid residues involved in electron transfer

These approaches can be complemented with computational modeling to predict interaction surfaces and electron transfer pathways based on the amino acid sequence provided in the available databases .

How does the function of Photosystem Q (B) protein differ from Photosystem II D2 protein (psbD) in Illicium oligandrum?

While both proteins are integral components of Photosystem II, they serve distinct but complementary roles in photosynthetic electron transport:

CharacteristicPhotosystem Q (B) Protein (psbA)Photosystem II D2 Protein (psbD)
UniProt IDA6MMS4A6MMT9
Length344 amino acids353 amino acids
Primary FunctionBinds QB (secondary electron acceptor)Binds QA (primary electron acceptor)
Electron TransferAccepts electrons from QA and transfers to plastoquinone poolAccepts electrons from pheophytin and transfers to QB via QA
Binding PartnersInteracts with D2 protein and cytochrome b559Forms heterodimer with D1 protein
Turnover RateHigher turnover due to photodamageMore stable than D1 protein

The two proteins form a heterodimeric core of Photosystem II, with D1 (Photosystem Q (B) protein) binding the secondary quinone acceptor QB and D2 binding the primary quinone acceptor QA . The amino acid sequences of these proteins (as provided in the search results) show structural similarities reflecting their evolutionary relationship, but with specific differences in the quinone-binding regions that determine their distinct functions .

What experimental approaches can distinguish between the roles of Photosystem Q (A) and Q (B) proteins in electron transport studies?

To differentiate between the functions of Photosystem Q (A) and Q (B) proteins in electron transport chains, researchers can employ several methodological approaches:

  • Selective Inhibition Studies:

    • Use DCMU (3-(3,4-dichlorophenyl)-1,1-dimethylurea) to specifically block electron transfer from QA to QB

    • Apply stigmatellin to inhibit electron transfer at the QB site

    • Monitor the differential effects on electron transport using fluorescence measurements

  • Site-Directed Mutagenesis:

    • Generate specific mutations in the binding pockets of QA (in the D2 protein) or QB (in the D1 protein)

    • Assess the impact on electron transport kinetics using chronoamperometry

    • Analyze changes in oxygen evolution rates as a functional readout

  • Time-Resolved Spectroscopy:

    • Measure the electron transfer kinetics with picosecond to millisecond resolution

    • Distinguish between the faster QA-related processes and slower QB-related processes

    • Correlate spectral changes with specific electron transfer events

  • Quinone Exchange Experiments:

    • Replace native plastoquinone with synthetic analogs having different redox potentials

    • Determine how these modifications differently affect QA versus QB functions

    • This approach has been used to engineer novel electron donation pathways in photosynthetic organisms

These methodologies can be applied to recombinant proteins expressed in heterologous systems or to isolated thylakoid membranes containing native protein complexes.

What are the common challenges in expressing and purifying Recombinant Illicium oligandrum Photosystem Q (B) protein, and how can they be addressed?

Expression and purification of membrane proteins like the Photosystem Q (B) protein present several technical challenges:

  • Poor Expression Yields:

    • Challenge: Membrane proteins often express poorly in heterologous systems

    • Solution: Optimize codon usage for the expression host; consider using specialized E. coli strains like C41(DE3) or C43(DE3) designed for membrane protein expression; reduce expression temperature to 18-20°C to improve folding

  • Protein Aggregation:

    • Challenge: Hydrophobic membrane proteins tend to aggregate during extraction

    • Solution: Screen multiple detergents (DDM, LDAO, Triton X-100) for solubilization; include glycerol (10-20%) in all buffers to enhance stability; consider fusion partners like MBP that can improve solubility

  • Maintaining Native Conformation:

    • Challenge: Retaining functional structure during purification

    • Solution: Incorporate native lipids (DGDG, MGDG) in purification buffers; purify under reducing conditions to prevent oxidation of critical cysteine residues; consider amphipol-based approaches for final purification steps

  • Degradation During Purification:

    • Challenge: Proteolytic degradation compromising yield and quality

    • Solution: Include protease inhibitor cocktails; maintain low temperature (4°C) throughout purification; minimize purification duration by optimizing protocols

A systematic approach to optimization, testing multiple conditions in parallel, is recommended to identify the optimal protocol for each research application .

How can researchers verify the functional activity of purified Recombinant Illicium oligandrum Photosystem Q (B) protein?

Verifying the functional integrity of purified Photosystem Q (B) protein requires assessing its electron transport capabilities and structural properties:

  • Oxygen Evolution Assays:

    • Reconstitute the purified protein with other Photosystem II components

    • Measure oxygen evolution rates using a Clark-type electrode

    • Compare activity to native Photosystem II preparations as positive control

  • Binding Assays with Quinone Analogs:

    • Use isothermal titration calorimetry (ITC) to measure binding affinity of plastoquinone and analogs

    • Determine binding stoichiometry and thermodynamic parameters

    • Compare with reported values for native protein

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Detect formation of semiquinone radical intermediates during electron transfer

    • Confirm correct environment of the QB binding site

  • Circular Dichroism (CD) Spectroscopy:

    • Assess secondary structure content to verify proper folding

    • Compare spectra with reference data for correctly folded protein

    • Monitor thermal stability through temperature-dependent CD measurements

  • Reconstitution into Liposomes or Nanodiscs:

    • Incorporate purified protein into artificial membrane systems

    • Assess electron transport functionality in a membrane environment

    • This approach bridges the gap between in vitro biochemical studies and native membrane function

A combination of these methods provides comprehensive validation of protein functionality prior to downstream applications .

How can cryo-electron microscopy be applied to study the structure and dynamics of Photosystem Q (B) protein?

Cryo-electron microscopy (cryo-EM) has revolutionized structural studies of membrane proteins, offering several advantages for investigating Photosystem Q (B) protein:

  • Sample Preparation Protocol:

    • Purify Recombinant Illicium oligandrum Photosystem Q (B) protein in detergent micelles or reconstitute into nanodiscs

    • Apply 3-4 μL of sample (concentration ~1-5 mg/mL) to glow-discharged holey carbon grids

    • Blot for 3-5 seconds and plunge-freeze in liquid ethane using a vitrification device

    • Store grids in liquid nitrogen until imaging

  • Data Collection Strategy:

    • Use a high-end cryo-EM microscope (e.g., Titan Krios with K3 direct electron detector)

    • Collect movies with 40-60 frames at 0.5-1.0 e-/Ų/frame

    • Target total dose of 40-60 e-/Ų across the entire exposure

    • Use beam-tilt pairs for improved CTF estimation

  • Image Processing Workflow:

    • Perform motion correction and dose-weighting using MotionCor2

    • Estimate CTF parameters with CTFFIND4 or Gctf

    • Select particles automatically with crYOLO or Topaz, followed by manual curation

    • Conduct 2D and 3D classification in RELION or cryoSPARC

    • Perform high-resolution refinement with particle polishing

  • Structural Analysis:

    • Build atomic models based on the density map using established Photosystem II structures as templates

    • Validate quinone binding sites through mutagenesis studies

    • Correlate structural features with functional data from biochemical assays

This approach can reveal conformational changes associated with different functional states, particularly those related to the QB binding site dynamics during the electron transport cycle.

What are the applications of Recombinant Illicium oligandrum Photosystem Q (B) protein in synthetic biology and bioenergy research?

The Recombinant Illicium oligandrum Photosystem Q (B) protein offers several promising applications in synthetic biology and bioenergy research:

  • Engineered Electron Transport Systems:

    • Redesign the QB binding pocket to accept synthetic electron mediators

    • Create hybrid systems capable of transferring photosynthetic electrons to non-native acceptors

    • This approach has been demonstrated with other Photosystem II proteins, where modifications to the environment of the Q site increased the reduction rate of synthetic mediators like 2,6-dimethyl-p-benzoquinone (DMBQ)

  • Bio-hybrid Solar Cells:

    • Incorporate engineered Photosystem Q (B) protein into electrodes

    • Develop systems where photosynthetic electron transport is coupled to electricity generation

    • Optimize protein-electrode interfaces for efficient electron transfer

  • Directed Evolution for Enhanced Function:

    • Create libraries of Photosystem Q (B) protein variants through random or semi-rational mutagenesis

    • Screen for improved properties such as stability, electron transfer efficiency, or tolerance to environmental stressors

    • Apply the successful mutations to design more robust photosynthetic systems

  • Metabolic Engineering:

    • Integrate modified Photosystem Q (B) proteins into engineered metabolic pathways

    • Channel photosynthetic reducing power toward the production of high-value compounds

    • Develop systems for light-driven biosynthesis of fuels or chemicals

These applications represent areas where the fundamental understanding of Photosystem Q (B) protein structure and function can be translated into biotechnological innovations for sustainable energy and chemical production .

What genomic and proteomic approaches can advance our understanding of Photosystem Q (B) protein evolution and function in Illicium oligandrum?

Future research on Photosystem Q (B) protein could benefit from integrative genomic and proteomic approaches:

  • Comparative Genomics:

    • Expand chloroplast genome sequencing across the Illicium genus and related early-diverging angiosperms

    • Analyze the evolution of the psbA gene in relation to plastome structure and IR boundary dynamics

    • Research has already shown distinctive patterns in the chloroplast genome of Illicium oligandrum, particularly regarding IR expansion and contraction

    • Further studies could investigate how these genomic features correlate with Photosystem function

  • Transcriptomics Under Varying Conditions:

    • Profile gene expression changes in response to different light qualities and intensities

    • Identify regulatory networks controlling psbA expression

    • Compare with expression patterns of other photosystem components to understand coordinated regulation

  • Proteomics of Protein-Protein Interactions:

    • Apply proximity-dependent biotin identification (BioID) to map the protein interaction network

    • Use hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify conformational changes during function

    • Develop an interactome map specific to Illicium oligandrum photosynthetic apparatus

  • Single-Molecule Studies:

    • Apply single-molecule fluorescence techniques to study the dynamics of electron transfer

    • Investigate protein conformational changes during the catalytic cycle

    • Correlate structural dynamics with functional states

These approaches would provide a more comprehensive understanding of how Photosystem Q (B) protein functions within the broader context of photosynthetic electron transport and how its structure-function relationship has evolved in Illicium oligandrum compared to other photosynthetic organisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.