Recombinant Inclusion membrane protein A (incA)

Shipped with Ice Packs
In Stock

Description

Definition of Recombinant Inclusion Membrane Protein A (IncA)

Recombinant Inclusion Membrane Protein A (IncA) refers to a bacterially-produced form of the IncA protein, which is a key component found in Chlamydia species . IncA is integral to the formation and function of inclusions, which are specialized vacuoles where Chlamydia replicates within host cells . The recombinant form of IncA is often utilized in research to study its structure, interactions, and role in Chlamydia pathogenesis .

Role and Significance of IncA

IncA is a transmembrane protein that plays a crucial role in the Chlamydia infection cycle . Its functions include:

  • Inclusion Fusion: IncA promotes the fusion of multiple inclusions into a larger one, which is essential for the efficient growth and replication of Chlamydia .

  • Interaction with Host Proteins: IncA interacts with various host cell proteins, such as G3BP1, modulating host cell functions and aiding in immune evasion .

  • Structural Integrity: It contributes to the structural integrity of the inclusion membrane .

Functional Interactions of IncA

IncA interacts with several host cell proteins, influencing the infection process. One notable interaction is with G3BP1, a host protein involved in various cellular processes .

  • G3BP1 Interaction: IncA interacts directly with G3BP1, affecting c-Myc protein concentration in host cells . Overexpression of IncA leads to a decrease in c-Myc protein levels, which can be reversed by using IncA mutants that cannot bind to G3BP1 .

  • Modulation of Host Cell Functions: By interacting with G3BP1, IncA modulates host cell functions, potentially aiding in immune evasion and promoting a favorable environment for Chlamydia replication .

Research Findings and Studies Involving IncA

Several studies have focused on IncA to elucidate its functions and interactions.

Study FocusKey Findings
Functional Interaction with Host Protein G3BP1 Demonstrated the interaction between IncA and G3BP1, showing that IncA overexpression leads to a decrease in c-Myc protein concentration. Mutant IncA constructs unable to interact with G3BP1 did not cause this decrease.
Crystal Structure Analysis Revealed that IncA folds into a stable, non-canonical four-helix bundle maintained as a monomer through intramolecular interactions. The monomeric conformation is critical for its membrane fusion activity.
Integrative Annotation Scores of Variants for Impact on RBP Activities INCA (Integrative annotation scores of variants for impact on RBP activities) is a multi-step genetic variant scoring approach that leverages the ENCODE RBP data together with ClinVar and integrates multiple computational approaches to aggregate evidence. INCA enhances variant scoring for RBP impact with auxiliary data, thereby accentuating the impact of variants on RBP interactions with the DNA.

Methods for Studying IncA

Various methods are employed to study IncA, including:

  • Yeast Two-Hybrid System: Used to identify protein-protein interactions, such as the interaction between IncA and G3BP1 .

  • GST Pull-Down and Co-Immunoprecipitation: Techniques used to confirm in vitro and in vivo interactions between IncA and host proteins .

  • Fluorescence Microscopy: Utilized to visualize the localization of proteins, such as G3BP1, near the inclusion membrane in infected cells .

  • Site-Directed Mutagenesis: Employed to create IncA mutants with specific functional defects, such as the inability to interact with G3BP1 .

  • X-ray Crystallography: Used to determine the high-resolution structure of IncA, providing insights into its functional mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format during order placement for guaranteed fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Chlamydia trachomatis
Target Names
incA
Target Protein Sequence
MTTPTLIVTPPSPPAPSYSANRVPQPSLMDKIKKIAAIASLILIGTIGFLALLGHLVGFL IAPQITIVLLALFITSLAGNALYLQKTANLHLYQDLQREVGSLKEINFMLSVLQKEFLHL SKEFATTSKDLSAVSQDFYSCLQGFRDNYKGFESLLDEYKNSTEEMRKLFSQEIIADLKS SVASLREEIRFLTPLAEEVRRLAHNRESLTAAIEELKTIRDSLRDEIGQLSQLSRTLTSQ IALQRKESSDLCSQIRETLSSPRKSASPSTKSS
Uniprot No.

Q&A

What is the basic structure of IncA protein and how does it relate to its function?

IncA is a Chlamydia trachomatis inclusion membrane protein with a distinctive structure consisting of:

  • An N-terminal region containing two transmembrane helices that insert into the inclusion membrane

  • A cytoplasmic C-terminal region that contributes to oligomerization

  • Two segments in the C-terminal region (SL1 and SL2) exhibiting similarity to eukaryotic SNARE motifs

The protein's architecture serves its function in promoting homotypic fusion of chlamydial inclusions. Research has shown that both the transmembrane domain and the cytoplasmic region can independently oligomerize, with the SL2 motif specifically involved in homotypic interactions .

How do the SNARE-like motifs of IncA contribute to inclusion fusion? (Advanced)

The SL2 motif of IncA plays a crucial role in mediating protein-protein interactions necessary for inclusion fusion. BACTH (Bacterial Two-Hybrid) studies have demonstrated that:

  • The SL2 motif interacts with itself, the C-terminal domain, and full-length IncA

  • SL2 does not interact with the N-terminal transmembrane region

  • The SL1 motif shows no detectable interactions in the same assay system

This interaction pattern suggests that IncA may facilitate fusion through a mechanism similar to eukaryotic SNARE proteins, where the SL2 motifs from IncA molecules on separate inclusions form stable helical bundles, bringing the membranes into close proximity to enable fusion . Delevoye et al. (2008) showed that these SNARE-like motifs not only mediate IncA self-interaction but also enable interactions with host cell SNAREs, potentially hijacking cellular membrane fusion machinery .

What atomic-level insights have been gained about IncA structure? (Advanced)

Recent structural studies have revealed that the cytoplasmic domain of IncA forms a non-canonical four-helix bundle. This structure provides insights into the molecular mechanism by which IncA mediates inclusion fusion. Key findings include:

  • The identification of an intramolecular clamp that is essential for IncA-mediated homotypic membrane fusion

  • Structure-based mutagenesis combined with molecular dynamics simulation has confirmed functional domains

  • The cytoplasmic domain architecture explains how IncA can both self-associate and interact with host SNARE proteins

What expression systems are most effective for producing functional recombinant IncA?

Escherichia coli remains the most widely used bacterial host for recombinant IncA production due to:

  • Fast growth rate (20-minute generation time under optimized conditions)

  • Well-developed molecular manipulation tools

  • Ability to achieve high cell density using inexpensive culture reagents

Expression SystemAdvantagesChallengesBest For
E. coli Lemo21(DE3)Tunable expression for membrane proteinsRequires optimization of inducer levelsBalancing expression and proper folding
E. coli C41(DE3)/C43(DE3)Mutations in lacUV5 promoter reducing toxicityLimited to certain membrane proteinsToxic membrane proteins
E. coli SHuffleEnhanced disulfide bond formationMay still require optimizationProteins requiring disulfide bonds
E. coli with co-expressed chaperonesImproved foldingRequires additional plasmidsProteins prone to misfolding

For IncA specifically, using strains with dampened T7 RNA polymerase expression via repression by mutant LacI repressor protein (mLacI) has shown promising results for membrane protein expression .

How can researchers optimize expression conditions to prevent IncA aggregation? (Advanced)

Preventing IncA aggregation during recombinant expression requires a multi-faceted approach:

  • Reduce expression rate:

    • Use weak promoters (tac, araC, or synthetic trc) instead of strong T7 promoters

    • Employ low-copy number plasmids (0-50 copies/cell) rather than high-copy plasmids

    • Lower induction temperature (16-25°C) to slow folding and reduce aggregation

  • Optimize host strains:

    • Use specialized strains like E. coli BL21(DE3) pLysS to control basal expression

    • Consider Lemo21(DE3) for tunable expression via rhamnose-inducible T7 lysozyme

  • Co-express molecular chaperones:

    • GroEL/GroES system (can provide up to 38-fold improvement for difficult proteins)

    • DnaK/DnaJ/GrpE system (KJE)

    • ClpB and small heat shock chaperones IbpA and IbpB

  • Engineering fusion constructs:

    • Consider fusing IncA to highly soluble protein partners

    • Explore DNA-binding domain fusions (plasmid display technology) to stabilize the protein

Monitoring expression through small-scale time-course experiments is essential to identify optimal conditions before scaling up.

What strategies can overcome challenges in purifying membrane proteins like IncA?

Purification of membrane proteins such as IncA presents significant challenges due to their hydrophobic nature. Effective strategies include:

  • Membrane extraction optimization:

    • Test different detergents (DDM, LDAO, Triton X-100) for efficiency in solubilizing IncA

    • Use mild solubilization conditions to maintain protein structure

    • Consider native nanodiscs or amphipols for stabilizing the protein in solution

  • Affinity tag selection:

    • N-terminal tags may be preferable as C-terminal regions often contain functional domains

    • His6 tags allow purification under both native and denaturing conditions

    • Consider removable tags with protease cleavage sites

  • Refolding approaches (if inclusion bodies form):

    • Solubilize inclusion bodies with 8M urea or 6M guanidine hydrochloride

    • Use step-wise dialysis to gradually remove denaturant

    • Add stabilizers like glycerol (10%) during refolding

    • Employ oxidizing agents to reform disulfide bonds if necessary

When working with inclusion bodies, consider that they can provide a purification advantage as they often contain nearly pure target protein (>90%) .

Why is expressing IncA as a recombinant protein particularly challenging?

Expressing IncA presents multiple challenges stemming from its nature as both a membrane protein and a bacterial effector:

  • Membrane protein challenges:

    • Hydrophobic transmembrane domains tend to cause protein aggregation

    • Insertion into E. coli membranes can saturate membrane protein biogenesis pathways

    • Proper folding requires correct membrane insertion and topology

  • Chlamydial protein-specific challenges:

    • Potential codon usage bias between Chlamydia and expression hosts

    • Native post-translational modifications may be absent in heterologous systems

    • Toxicity to host cells when expressed at high levels

  • Expression rate-related issues:

    • High expression rates overwhelm cellular folding machinery

    • Strong promoters lead to cytoplasmic accumulation before membrane insertion

    • Metabolic burden from increased energy demand stresses host cells

These challenges typically manifest as inclusion body formation, low yields of functional protein, or host cell growth inhibition.

How can researchers design constructs to facilitate proper folding of recombinant IncA? (Advanced)

Strategic construct design is crucial for successful expression of properly folded IncA:

  • Domain-based expression:

    • Express functional domains separately (N-terminal transmembrane region vs. C-terminal cytoplasmic region)

    • BACTH studies have confirmed that both domains can independently fold and function

  • Fusion protein strategies:

    • N-terminal fusions with highly soluble partners (MBP, SUMO, Thioredoxin)

    • Consider Oct-1 DNA-binding domain fusion (plasmid display method) which has shown promise for membrane proteins

  • Codon optimization:

    • Adjust codons to match expression host preference

    • Remove rare codons that may cause translational pausing and misfolding

  • Signal sequence modifications:

    • Optimize signal sequences for proper membrane targeting

    • Consider using E. coli native membrane protein signal sequences

  • Truncation approaches:

    • Express minimal functional domains (e.g., SL2 motif for interaction studies)

    • Remove potentially problematic regions that contribute to aggregation

For IncA specifically, successful studies have used constructs focusing on specific functional domains rather than the full-length protein, as demonstrated in BACTH experiments .

What are the most effective approaches for solubilizing IncA inclusion bodies? (Advanced)

When IncA forms inclusion bodies, the following solubilization approach has proven effective:

  • Isolation and washing:

    • Harvest cells and disrupt by sonication or homogenization

    • Isolate inclusion bodies by differential centrifugation

    • Wash thoroughly with detergents (0.5-1% Triton X-100) to remove membrane fragments

    • Perform additional washes with low concentrations of urea (1-2M) to remove contaminants

  • Solubilization:

    • Use strong denaturants: 8M urea, 6M guanidine-HCl, or combinations with detergents

    • Include reducing agents (5-10mM DTT or β-mercaptoethanol) if disulfide bonds are present

    • Optimize pH conditions (typically pH 8.0) to enhance solubilization

  • Refolding strategies:

    • Dialysis: Gradual removal of denaturant through multiple buffer exchanges

    • Dilution: Rapid dilution into refolding buffer with stabilizers

    • On-column refolding: Immobilize denatured protein on affinity resin before refolding

    • For membrane proteins like IncA, add detergents or lipids during refolding to stabilize transmembrane domains

  • Refolding additives:

    • Non-detergent sulfobetaines (NDSBs)

    • L-arginine (0.4-0.8M) to prevent aggregation

    • Glycerol (10-20%) to stabilize partially folded intermediates

    • Low concentrations of detergents appropriate for membrane proteins

The recombinant protein is often the major component of inclusion bodies, making this preparation an initial purification step of significant importance .

What techniques are most effective for studying IncA-IncA interactions?

Several complementary techniques have proven effective for investigating IncA-IncA interactions:

  • Bacterial Two-Hybrid (BACTH) analysis:

    • Successfully used to confirm IncA oligomerization

    • Revealed that both N-terminal (transmembrane) and C-terminal domains can independently oligomerize

    • Identified specific involvement of the SL2 motif in homotypic interaction

    • Advantages: works in bacterial membrane environment, detects interactions in near-native conditions

  • Co-immunoprecipitation (Co-IP):

    • Used to validate protein interactions identified by other methods

    • Can be performed with tagged versions of IncA expressed in Chlamydia

    • Requires careful optimization of detergent conditions for membrane proteins

  • Membrane fractionation:

    • Confirms proper insertion of IncA into membranes

    • Western blot analysis of different cellular fractions reveals protein localization

    • Important control for interaction studies to verify proper protein targeting

  • Fluorescence-based techniques:

    • FRET (Förster Resonance Energy Transfer) for detecting protein proximity

    • Bimolecular Fluorescence Complementation (BiFC) for visualizing interactions in cells

    • Particularly useful for studying interactions in the context of the inclusion membrane

When selecting techniques, consider the specific aspects of IncA interactions being investigated and the experimental context (in vitro vs. in vivo).

How effective is the BACTH system for studying IncA and other Inc protein interactions? (Advanced)

The Bacterial Two-Hybrid (BACTH) system has proven highly effective for studying IncA and other Inc protein interactions, with several key advantages:

  • Validation with known interactions:

    • Successfully confirmed IncA oligomerization previously established by other methods

    • Accurately detected Ct222-Ct850 interactions that were confirmed by co-immunoprecipitation

    • Precisely mapped interaction domains within IncA (SL2 vs. SL1 motifs)

  • Novel interaction discovery:

    • Revealed previously unknown homo-oligomerization of multiple Inc proteins (IncC, IncD, IncF, Ct005)

    • Identified numerous novel interactions between different Inc proteins

    • Found specific Inc proteins (IncF, IncD, Ct222) that interact with multiple partners, suggesting they form interaction nodes

  • Technical advantages for membrane proteins:

    • Allows interaction study in membrane environment similar to native conditions

    • Detects weak or transient interactions due to enzymatic amplification

    • Cell fractionation confirms proper membrane insertion of fusion proteins

  • Limitations:

    • Some Inc proteins (IncB, IncE, Ct101, Ct134, Ct135, Ct227) showed no interactions

    • May not detect interactions requiring specific chlamydial or eukaryotic components

    • Fusion tags may occasionally interfere with protein folding or interactions

For maximum reliability, BACTH results should be verified using complementary approaches such as co-immunoprecipitation or in vivo functional studies.

What genetic approaches are available for studying IncA function in Chlamydia? (Advanced)

Recent advances have expanded the genetic toolkit for studying IncA function directly in Chlamydia:

  • Conditional mutant generation:

    • Creation of conditional expression systems where IncA expression can be regulated

    • Use of inducible promoters (e.g., tetracycline-inducible systems) to control expression levels

    • Enables study of IncA function at different stages of the infection cycle

  • Insertional inactivation:

    • Targeted disruption of the incA gene using mobile genetic elements

    • Results in non-fusogenic inclusions, confirming IncA's role in inclusion fusion

    • Can be complemented with full-length IncA to rescue the fusion phenotype

  • Domain complementation studies:

    • Use of complementation with constructs containing different functional domains

    • Demonstrated that inclusion fusion rescue requires the functional core consisting of SLD-1 and part of SLD-2

    • Confirms in vivo relevance of domains identified in in vitro studies

  • Site-directed mutagenesis:

    • Introduction of specific mutations in functional domains

    • Structure-based mutagenesis guided by atomic structures

    • Allows precise dissection of structure-function relationships

These genetic approaches represent significant advancements in Chlamydia research, as genetic manipulation of this obligate intracellular pathogen has historically been challenging.

How can researchers assess IncA's role in inclusion fusion?

Multiple complementary approaches can assess IncA's role in inclusion fusion:

  • Microscopy-based fusion assays:

    • Infect cells with multiple elementary bodies to generate multiple inclusions

    • Quantify inclusion fusion events over time using fluorescence microscopy

    • Compare wild-type strains with IncA mutants or under IncA-inhibiting conditions

  • Functional complementation:

    • Express recombinant IncA in IncA-deficient strains

    • Assess rescue of fusion phenotype with full-length or domain-specific constructs

    • Determine which domains are essential for function (SLD-1 and part of SLD-2 are required)

  • In vitro membrane fusion assays:

    • Reconstitute IncA in artificial membrane systems (liposomes)

    • Measure lipid mixing or content mixing as indicators of membrane fusion

    • Test effects of specific mutations or inhibitors on fusion efficiency

  • Dominant negative approaches:

    • Express mutant IncA versions expected to interfere with native IncA function

    • Assess impact on inclusion fusion in wild-type Chlamydia

    • Useful for determining critical functional residues or domains

These assays collectively provide a comprehensive assessment of IncA's fusion-promoting activity and the mechanisms involved.

What methods can detect IncA interactions with host cell proteins? (Advanced)

Several sophisticated approaches can characterize IncA's interactions with host cell components:

  • Proximity-dependent labeling:

    • BioID or APEX2 fusion to IncA expressed in infected cells

    • Allows identification of proximal proteins at the inclusion membrane

    • Mass spectrometry analysis of biotinylated proteins reveals interaction partners

  • Co-immunoprecipitation with crosslinking:

    • Chemical crosslinking preserves transient or weak interactions

    • Particularly valuable for membrane protein interactions

    • Can be performed with antibodies against native proteins or epitope tags

  • Split-protein complementation assays:

    • Luciferase or GFP complementation systems

    • Direct visualization of interactions in living cells

    • Provides spatial and temporal information about interactions

  • In vitro binding assays with purified components:

    • Surface Plasmon Resonance (SPR) for quantitative binding kinetics

    • Pull-down assays with recombinant proteins

    • Important for confirming direct interactions vs. indirect associations

  • Yeast two-hybrid membrane system variants:

    • Modified for membrane proteins (split-ubiquitin system)

    • Screening host cell protein libraries for IncA interactors

    • Complementary to bacterial two-hybrid approaches

Prior studies have shown that IncA interacts with eukaryotic SNARE proteins involved in membrane fusion pathways, highlighting the importance of these host-pathogen interaction studies .

How can the functional significance of specific IncA domains be assessed experimentally? (Advanced)

Determining the functional significance of specific IncA domains requires multifaceted experimental approaches:

  • Structure-guided mutagenesis:

    • Introduction of specific mutations based on structural data

    • Target residues involved in:

      • Oligomerization interfaces

      • SNARE-like motifs

      • The intramolecular clamp identified as essential for fusion

    • Test mutants in functional assays to establish structure-function relationships

  • Domain truncation and chimeric proteins:

    • Express truncated versions containing specific domains

    • Create chimeric proteins swapping domains between different Inc proteins

    • Assess ability to complement IncA-deficient strains

  • In vitro functional reconstitution:

    • Purify recombinant IncA domains

    • Reconstitute in liposomes or supported bilayers

    • Measure specific activities (e.g., membrane binding, oligomerization, fusion)

  • Localization studies with domain-specific constructs:

    • Express fluorescently tagged domains in infected cells

    • Determine requirements for proper inclusion membrane targeting

    • Assess co-localization with interaction partners

  • Molecular dynamics simulations:

    • Complement experimental data with computational approaches

    • Predict effects of mutations on protein structure and dynamics

    • Generate hypotheses for experimental testing

Research has confirmed that both transmembrane and cytoplasmic domains contribute to IncA function, with the SL2 motif specifically involved in homotypic interactions essential for inclusion fusion .

How does IncA contribute to Chlamydia's intracellular survival and replication?

IncA plays multiple critical roles in Chlamydia's intracellular lifecycle:

  • Inclusion fusion facilitation:

    • Promotes homotypic fusion of inclusions when multiple elementary bodies infect a cell

    • Creates a single unified inclusion that efficiently acquires nutrients

    • Enables coordinated bacterial development and maximizes replication efficiency

  • Inclusion membrane architecture:

    • Forms part of the membrane scaffold that maintains inclusion integrity

    • Oligomerizes to create stable protein complexes within the inclusion membrane

    • Interacts with other Inc proteins to form functional interaction networks

  • Host-pathogen interface functions:

    • Mediates interactions with host cell components

    • Interacts with host SNARE proteins to potentially modulate vesicular trafficking

    • May contribute to nutrient acquisition and avoidance of lysosomal fusion

  • Regulatory roles:

    • May participate in signaling pathways that influence bacterial development

    • Contributes to creating a specialized intracellular niche optimized for bacterial growth

    • Potentially regulates inclusion expansion to accommodate growing bacterial numbers

IncA's importance is underscored by the observation that IncA-deficient Chlamydia strains form non-fusogenic inclusions, demonstrating its essential role in normal inclusion development .

What is known about the role of IncA in modulating host cell responses? (Advanced)

IncA's interactions with host cellular machinery reveal sophisticated mechanisms for modulating host responses:

  • Interference with membrane trafficking:

    • IncA interacts with host SNARE proteins including Vamp3, Vamp7, and Vamp8

    • This interaction may disrupt normal vesicular trafficking pathways

    • Potential mechanism for avoiding lysosomal fusion while acquiring nutrients

  • Establishment of inclusion membrane microdomains:

    • IncA forms specific protein complexes with other Inc proteins

    • These complexes create specialized microdomains within the inclusion membrane

    • Different microdomains may interface with distinct host cell pathways

  • Potential immunomodulatory effects:

    • IncA's exposure to the host cytoplasm may influence immune recognition

    • Interactions with host cellular components could modulate inflammatory responses

    • May contribute to the establishment of persistent infections

  • Regulation of inclusion-cytoskeleton interactions:

    • Through interactions with other Inc proteins and host factors

    • Influences inclusion positioning within the host cell

    • May affect inclusion stability and integrity during infection

The multiple protein-protein interactions mediated by IncA, particularly those forming interaction nodes with other Inc proteins like IncF, IncD, and Ct222, suggest a complex role in organizing the host-pathogen interface .

How do mutations in IncA affect Chlamydia virulence? (Advanced)

Mutations in IncA have significant impacts on Chlamydia's pathogenic capabilities:

  • Effects on inclusion fusion:

    • Insertional inactivation of incA results in non-fusogenic inclusions

    • Multiple smaller inclusions instead of a single large inclusion

    • Reduced efficiency in nutrient acquisition and bacterial replication

  • Structural mutations:

    • Mutations in the intramolecular clamp region disrupt IncA's fusion-promoting activity

    • Structure-based mutagenesis confirms critical residues for function

    • Specific domains (SLD-1 and part of SLD-2) are essential for complementation of fusion defects

  • Clinical isolate variations:

    • Naturally occurring IncA-deficient clinical isolates have been identified

    • These strains show altered virulence and infection dynamics

    • May represent adaptation to specific host environments or immune pressures

  • Impact on infection outcomes:

    • IncA mutations potentially affect persistence and chronic infection

    • May influence inflammatory responses and tissue pathology

    • Could alter susceptibility to antimicrobial treatments

Complementation studies have confirmed that full-length IncA can completely rescue the fusion defect in incA mutants, directly linking the protein to this critical function in pathogenesis .

How can structural insights into IncA inform therapeutic development? (Advanced)

The unique structural features of IncA offer several promising avenues for therapeutic development:

  • Targeting the intramolecular clamp:

    • The atomic structure reveals a critical intramolecular clamp essential for fusion

    • Small molecules disrupting this clamp could inhibit IncA function

    • Structure-based drug design focusing on this feature could yield specific inhibitors

  • SNARE-like motif interaction inhibitors:

    • Compounds interrupting SL2-mediated interactions could prevent inclusion fusion

    • Peptide-based inhibitors mimicking SL2 motifs may competitively inhibit IncA function

    • Could potentially disrupt both IncA-IncA and IncA-host SNARE interactions

  • Transmembrane domain oligomerization blockers:

    • Targeting the oligomerization interface in the transmembrane domain

    • Lipophilic compounds that integrate into the membrane and disrupt IncA clustering

    • May prevent formation of functional IncA complexes in the inclusion membrane

  • Epitope-based vaccine approaches:

    • Identification of exposed, conserved epitopes within IncA

    • Development of antibodies that could neutralize IncA function

    • Potential for broadly protective immunity against Chlamydia infection

These approaches leverage our understanding of IncA's unique non-canonical four-helix bundle structure and its functional domains to develop targeted interventions .

What are the potential applications of IncA in protein engineering and synthetic biology?

IncA's unique structural and functional properties offer several innovative applications:

  • Engineered membrane fusion systems:

    • IncA-based synthetic fusion proteins for controlled membrane fusion

    • Applications in drug delivery systems requiring membrane penetration

    • Potential use in cell-cell fusion for research or therapeutic applications

  • Protein inclusion body technology:

    • Leveraging IncA's propensity to form highly homogenous inclusion bodies

    • Creating fusion proteins with IncA domains for easy purification

    • Exploiting the high purity of protein in inclusion bodies (>90%) for biotechnological applications

  • Membrane protein display platforms:

    • Using IncA's efficient membrane integration for surface display of peptides/proteins

    • Applications in protein engineering and directed evolution

    • Potential for developing novel biosensors based on IncA scaffolds

  • SNARE-mimetic synthetic biology tools:

    • Creating artificial cellular compartments with controlled fusion properties

    • Engineering organelle-targeting systems based on IncA's SNARE-like interactions

    • Developing synthetic cell division mechanisms inspired by inclusion fusion

The extensive characterization of IncA's structure-function relationships provides a foundation for these innovative applications beyond traditional therapeutic approaches.

How can high-throughput approaches advance our understanding of IncA and other Inc proteins? (Advanced)

Modern high-throughput technologies can significantly accelerate IncA research:

  • Comprehensive interaction mapping:

    • Systematic BACTH screening of all ~60 Inc proteins for interaction networks

    • Protein microarrays for detecting Inc-host protein interactions

    • Mass spectrometry-based interactomics for unbiased partner identification

    • Would expand on initial findings showing Inc proteins like IncF, IncD, and Ct222 form interaction nodes

  • Structure-function relationship screening:

    • Deep mutational scanning to comprehensively assess functional residues

    • CRISPR-based genetic screens in host cells to identify critical interaction partners

    • Functional genomics approaches to link Inc protein activities to specific host pathways

  • Advanced imaging approaches:

    • Super-resolution microscopy to visualize Inc protein organization within inclusions

    • Live-cell imaging with biosensors to track dynamic Inc-host interactions

    • Cryo-electron tomography to visualize inclusion membrane architecture

  • Computational approaches:

    • Machine learning to predict Inc protein functions from sequence

    • Molecular dynamics simulations to understand membrane integration and protein dynamics

    • Systems biology modeling of Inc protein interaction networks

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.