Recombinant Indian citrus ringspot virus Movement protein TGB2 (ORF3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery details.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ORF3; Movement protein TGB2; Triple gene block 2 protein; TGBp2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Indian citrus ringspot virus (isolate Kinnow mandarin/India/K1/1996) (ICRSV)
Target Names
ORF3
Target Protein Sequence
MPLQPPPDHTWAVRIIALGLAVTALIFTSTRDTSRHVGDPSHSLPFGGHYRDGSKVIHYN SPRSSKPSNHTPYLLFAPIGIILLIHALHRLGNSAHICRCTHCMPHSQT
Uniprot No.

Target Background

Function
This protein plays a crucial role in viral cell-to-cell propagation. It facilitates genome transport to neighboring plant cells through plasmodesmata.
Database Links

KEGG: vg:922109

Protein Families
Tymovirales TGBp2 protein family
Subcellular Location
Host endoplasmic reticulum membrane.

Q&A

What is the genomic organization of Indian citrus ringspot virus and where is TGB2 (ORF3) located?

Indian citrus ringspot virus (ICRSV), the type species of the genus Mandarivirus, possesses a single-stranded positive-sense RNA genome comprising 7,560 nucleotides (excluding the poly(A) tail). The genome is organized into six open reading frames (ORFs). The TGB2 protein is encoded by ORF3, which spans nucleotides 5718 to 6047, containing 330 nucleotides. This genomic region is part of the triple gene block (TGB) module which includes three partially overlapping ORFs: TGB1, TGB2, and TGB3 . Within the Alphaflexiviridae family, this genomic organization is relatively conserved, though ICRSV shows some distinctive features in its nucleotide composition (27.98% A, 32.12% C, 19.68% G, and 20.22% T) .

How does the ICRSV TGB2 protein compare structurally to other viral movement proteins?

When comparing with the binary movement block (BMB) systems, ICRSV TGB2 appears to be functionally more specialized than the BMB2 protein, which combines functions similar to both TGB2 and TGB3 proteins in some virus systems . Unlike the BMB system, where only two proteins (BMB1 and BMB2) are necessary for cell-to-cell movement, ICRSV utilizes the complete triple gene block system, demonstrating evolutionary divergence in viral movement strategies .

What are the optimal conditions for heterologous expression of recombinant ICRSV TGB2 protein?

For successful heterologous expression of recombinant ICRSV TGB2 protein, researchers commonly use Escherichia coli as the expression system with a His-tag for purification purposes . The following protocol has been established for optimal expression:

  • Vector selection: pET-based expression vectors containing an N-terminal His-tag are recommended for efficient expression and subsequent purification.

  • Expression conditions:

    • Host strain: BL21(DE3) or Rosetta(DE3) for improved expression of proteins with rare codons

    • Induction: 0.5-1.0 mM IPTG when culture reaches OD600 of 0.6-0.8

    • Temperature: 16-18°C for 16-20 hours (lowered temperature reduces inclusion body formation)

    • Media: Terrific Broth supplemented with appropriate antibiotics

  • Solubility considerations: Due to the hydrophobic transmembrane domains, TGB2 tends to form inclusion bodies. Addition of mild detergents (0.5-1% Triton X-100) to lysis buffers can improve solubility .

  • Purification strategy: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin, followed by size exclusion chromatography to remove aggregates and obtain homogeneous protein preparations.

What challenges are commonly encountered when purifying ICRSV TGB2, and how can they be addressed?

Purification of ICRSV TGB2 presents several challenges due to its membrane-associated nature:

  • Protein solubility issues: The hydrophobic transmembrane domains often lead to aggregation and inclusion body formation.

    • Solution: Use mild detergents (DDM, LDAO, or Triton X-100) in all purification buffers. Alternatively, consider including 6-8M urea for initial solubilization followed by step-wise dialysis for refolding.

  • Protein stability concerns: Purified TGB2 tends to precipitate during concentration and storage.

    • Solution: Include 6% trehalose in storage buffers and maintain pH at 8.0 in Tris/PBS-based buffer systems . Store in small aliquots to avoid repeated freeze-thaw cycles.

  • Maintaining native conformation: Ensuring proper folding of the recombinant protein.

    • Solution: Consider co-expression with molecular chaperones (GroEL/GroES) or use insect cell or plant-based expression systems for proteins requiring complex folding.

  • Purity assessment: Standard SDS-PAGE may not accurately represent purity due to aberrant migration of membrane proteins.

    • Solution: Combine multiple analytical techniques including SDS-PAGE, size exclusion chromatography, and mass spectrometry for comprehensive purity assessment.

How does TGB2 contribute to the cell-to-cell movement mechanism of ICRSV?

TGB2 plays a critical role in the intracellular and cell-to-cell movement of ICRSV through several coordinated functions:

  • Membrane association and vesicle formation: TGB2 associates with the endoplasmic reticulum (ER) and forms mobile vesicle-like structures that move along the ER network . These vesicles serve as carriers for viral ribonucleoprotein complexes containing viral RNA and TGB1 protein.

  • Interaction with endocytic pathway: Research on related TGB-containing viruses demonstrates that TGB2 interacts with components of the endocytic pathway, including early endosomes marked by Rab5 orthologs such as Ara7 . This interaction suggests that TGB2 may exploit endocytic recycling for efficient viral movement.

  • Coordination with other TGB proteins: TGB2 functions in concert with TGB1 and TGB3 to facilitate cell-to-cell movement. While TGB1 binds viral RNA, TGB2 provides the membrane association capability, and TGB3 likely directs the complex to plasmodesmata .

  • Plasmodesmata modification: The TGB proteins collectively modify plasmodesmata structure and permeability to allow passage of viral material to adjacent cells. TGB2's role in this process appears to involve recruiting viral ribonucleoprotein complexes to membrane-associated sites near plasmodesmata .

What protein-protein interactions are critical for ICRSV TGB2 function in viral movement?

Several key protein-protein interactions facilitate ICRSV TGB2 function:

  • TGB2-TGB1 interaction: TGB2 interacts with TGB1 to recruit the viral RNA-binding protein to membrane compartments. This interaction is essential for directing the viral ribonucleoprotein complex along the intracellular movement pathway .

  • TGB2-TGB3 interaction: In related viruses, TGB2 and TGB3 form a functional complex that determines the subcellular targeting of viral movement components. TGB3 often contains signals for plasmodesmata targeting, while TGB2 enables membrane association .

  • Interaction with host factors: Research on related viral TGB2 proteins has revealed interactions with host factors, including a tobacco protein belonging to the RME-8 family of J-domain chaperones, which are essential for endocytic trafficking . This interaction suggests that TGB2 may hijack components of the host endocytic pathway to facilitate viral movement.

  • Membrane-protein interactions: The transmembrane domains of TGB2 interact with cellular membranes, particularly the ER, enabling the formation of motile granules and vesicles that travel along the ER network and transvacuolar strands .

What is the subcellular localization pattern of ICRSV TGB2 during infection?

The subcellular localization of ICRSV TGB2 follows a dynamic pattern during infection:

  • Initial ER association: TGB2 primarily localizes to the endoplasmic reticulum network and membranes surrounding the nucleus upon expression .

  • Formation of mobile structures: As infection progresses, TGB2 forms fluorescent spots and aggregates that move along the ER and transvacuolar strands, suggesting active trafficking of viral components .

  • Peripheral accumulation: Stationary aggregates containing TGB2 are observed at the cell periphery, likely representing sites near plasmodesmata where viral components prepare for cell-to-cell transport .

  • Endosome association: TGB2 colocalizes with markers of the endocytic pathway, including FM4-64 (a marker for plasma membrane internalization) and Ara7 (a Rab5 ortholog marking early endosomes), indicating involvement of the endocytic pathway in viral movement .

  • Plasmodesmata-associated localization: In some related viruses, TGB2 in combination with TGB3 forms pairs of fluorescent spots across neighboring cell walls, suggesting localization at or near plasmodesmata .

What fluorescent protein fusion strategies are most effective for studying ICRSV TGB2 localization?

For effective visualization of ICRSV TGB2 localization in plant cells, several fluorescent protein fusion strategies have proven successful:

How can researchers effectively assess the RNA-binding capabilities of recombinant ICRSV TGB2?

To assess the RNA-binding capabilities of recombinant ICRSV TGB2, researchers can employ several complementary approaches:

  • Northwestern blot analysis: This technique has previously demonstrated that TGB2 of PMTV can bind RNA . The procedure involves:

    • Separating purified recombinant TGB2 by SDS-PAGE

    • Transferring to nitrocellulose membranes

    • Renaturation of proteins on the membrane

    • Incubation with radiolabeled RNA probes

    • Detection of RNA-protein complexes by autoradiography

  • Electrophoretic mobility shift assay (EMSA):

    • Incubate purified TGB2 with labeled RNA fragments of interest

    • Analyze complex formation by native gel electrophoresis

    • Quantify binding affinity through titration experiments with varying protein concentrations

  • Filter-binding assays:

    • Simple quantitative method for measuring protein-RNA interactions

    • Requires radiolabeled or fluorescently labeled RNA

    • Protein-RNA complexes are retained on nitrocellulose filters while free RNA passes through

  • Fluorescence anisotropy:

    • Measure changes in the rotational diffusion of fluorescently labeled RNA upon protein binding

    • Allows real-time monitoring of binding kinetics and determination of binding constants

  • Surface plasmon resonance (SPR):

    • Immobilize either TGB2 or RNA on a sensor chip

    • Monitor binding in real-time through changes in refractive index

    • Determine association and dissociation rates as well as binding affinities

What approaches are recommended for studying the interaction of ICRSV TGB2 with membranes?

For investigating ICRSV TGB2-membrane interactions, the following approaches are recommended:

  • Membrane flotation assays:

    • Mix purified TGB2 with liposomes of defined composition

    • Subject mixture to sucrose gradient centrifugation

    • TGB2 associated with membranes will float with liposomes to lower density fractions

    • Analyze fractions by Western blotting to determine membrane association

  • Fluorescence microscopy of GFP-TGB2 in plant expression systems:

    • Express GFP-TGB2 transiently in plant cells

    • Use confocal microscopy to visualize association with cellular membranes

    • Perform co-localization with membrane markers (e.g., ER-tracker, HDEL-mCherry)

    • Track dynamic movements along the ER network and transvacuolar strands

  • Liposome binding assays:

    • Prepare liposomes with varying lipid compositions reflecting plant membrane systems

    • Incubate with purified TGB2

    • Separate bound and unbound protein by centrifugation or size exclusion chromatography

    • Quantify binding to determine lipid preferences and requirements

  • Electron microscopy techniques:

    • Immunogold labeling of TGB2 in infected tissue sections

    • Negative staining of liposome-TGB2 complexes

    • Cryo-electron microscopy for structural analysis of membrane-inserted TGB2

  • Lipid overlay assays:

    • Spot various lipids on membranes

    • Incubate with purified TGB2

    • Detect bound protein using antibodies against TGB2 or its tag

    • Identify specific lipid interactions that may regulate membrane association

How might targeted mutations in the conserved hydrophilic motif of ICRSV TGB2 affect viral movement?

The conserved hydrophilic motif (GDPSHSLPFGGHYRDGSKVIHYN) in TGB2 represents a crucial functional domain that is maintained across the Alphaflexiviridae family . Targeted mutations in this region could provide significant insights into TGB2 function through several approaches:

  • Alanine scanning mutagenesis:

    • Systematically replace each residue with alanine

    • Test mutant proteins for:

      • Membrane association capability

      • RNA binding activity

      • Interaction with TGB1 and TGB3

      • Ability to complement movement-deficient viral mutants

    Expected outcomes: Mutations in the highly conserved G-G-x-Y-R/K-D-G motif within this region would likely disrupt protein function more severely than mutations in less conserved positions .

  • Charge reversal mutations:

    • Focus on charged residues (D, H, R, K) within the motif

    • Create charge reversals (e.g., positive to negative) to disrupt electrostatic interactions

    • Assess effects on protein-protein and protein-RNA interactions

  • Cross-species chimeric constructs:

    • Replace the hydrophilic motif with corresponding sequences from related viruses

    • Determine if function is conserved across evolutionary divergent sequences

    • Identify minimal sequence requirements for functionality

This targeted mutagenesis approach would help elucidate the specific contributions of the conserved hydrophilic motif to TGB2 function in viral movement and potentially identify key residues for therapeutic targeting.

What is the potential role of ICRSV TGB2 in the recombination events observed in the viral genome?

Recombination analysis of the ICRSV genome has revealed potential recombination events, particularly in the TGB2 region (breakpoint 5,777 to 5,999 nt) between Lily virus X and Garlic virus C . The potential role of TGB2 in these recombination events could be investigated through:

  • Recombination hotspot analysis:

    • Compare sequences from multiple ICRSV isolates to identify recombination frequency in the TGB2 region

    • Analyze sequence features (e.g., secondary structures, sequence motifs) that might promote recombination

    • Determine if TGB2 sequence variability correlates with recombination frequency

  • In vitro recombination assays:

    • Develop template-switching assays using purified viral RNA-dependent RNA polymerase

    • Include TGB2 RNA sequences to test if they promote template switching

    • Compare recombination frequencies between wild-type and mutated TGB2 sequences

  • Evolutionary implications:

    • Since Mandarivirus is found only on the Indian subcontinent, investigate if TGB2 recombination contributes to host adaptation or geographical restriction

    • Compare TGB2 sequences across different virus families to trace evolutionary pathways and potential recombination events

Understanding TGB2's role in viral recombination would provide insights into viral evolution and adaptation mechanisms, potentially informing strategies for developing recombination-resistant viral strains for crop protection.

How does ICRSV TGB2 interact with the host endocytic pathway, and can this interaction be therapeutically targeted?

Research on related viral TGB2 proteins has revealed interactions with the host endocytic pathway, suggesting a potential therapeutic target . This interaction could be further investigated through:

  • Comprehensive protein-protein interaction mapping:

    • Perform yeast two-hybrid screening or co-immunoprecipitation followed by mass spectrometry to identify host interactors

    • Focus specifically on proteins involved in the endocytic pathway

    • Validate key interactions through in planta confirmation methods (BiFC, FRET)

  • Functional endocytosis assays:

    • Use endocytosis inhibitors to determine effects on TGB2 localization and viral movement

    • Track co-trafficking of TGB2 with endocytic markers using live-cell imaging

    • Explore if TGB2 alters normal endocytic recycling processes

  • RME-8 chaperone interaction analysis:

    • Further characterize the interaction between TGB2 and the RME-8 family of J-domain chaperones

    • Determine binding interfaces through targeted mutagenesis

    • Assess if this interaction is conserved in ICRSV TGB2

  • Therapeutic targeting strategies:

    • Design small molecule inhibitors or peptides that disrupt TGB2-endosome interactions

    • Test compounds for ability to block viral movement without affecting normal endocytic function

    • Evaluate potential for broad-spectrum activity against multiple TGB-containing plant viruses

Potential Therapeutic Targets in TGB2-Endocytic PathwayApproachExpected OutcomePotential Challenges
TGB2-RME-8 interaction interfaceSmall molecule inhibitorsDisruption of viral traffickingSpecificity for viral versus host processes
TGB2 membrane insertionLipid-binding competitive inhibitorsPrevention of vesicle formationDelivery to appropriate cellular compartments
TGB2-TGB3 interactionInterfering peptidesBlock of plasmodesmata targetingPeptide stability in plant systems
Early endosome recruitmentRab5 activity modulatorsInhibition of endocytic recycling of viral componentsPotential host toxicity

Targeting these interactions could provide novel approaches for developing antiviral strategies against ICRSV and related viruses that employ similar movement mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.