Recombinant Infectious hematopoietic necrosis virus Glycoprotein G (G)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
G; Glycoprotein; Spike glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-508
Protein Length
full length protein
Species
Infectious hematopoietic necrosis virus (strain Round Butte) (IHNV)
Target Names
G
Target Protein Sequence
QTVKPDTASESDQPTWSNPLFTYPEGCTLDKLSKVNASQLRCPRIFDDENRGLIAYPTSI
RSLSVGNDLGEIHTQGNHIHKVLYRTICSTGFFGGQTIEKALVEMKLSTKEAGAYDTTTA
AALYFPAPRCQWYTDNVQNDLIFYYTTQKSVLRDPYTRDFLDSDFIGGKCTKSPCQTHWS
NVVWMGDAGIPACDSSQEIKAHLFVDKISNRVVKATSYGHHPWGLHRACMIEFCGKQWIR
TDLGDLISVEYNSGAEILSFPKCEDKTMGMRGNLDDFAYLDDLVKASESREECLEAHAEI
ISTNSVTPYLLSKFRSPHPGINDVYAMHKGSIYHGMCMTVAVDEVSKDRTTYRAHRATSF
TKWERPFGDEWEGFHGLHGNNTTIIPDLEKYVAQYKTSMMEPMSIKSVPHPSILAFYNET
DLSGISIRKLDSFDLQSLHWSFWPTISALGGIPLVLLLAVAACCCWSGRPPTPSAPQSIP
MYHLANRS
Uniprot No.
Target Background
Function
This protein binds to a specific cellular surface receptor, initiating viral attachment. It plays a crucial role in determining host range and virulence. As a Class I viral fusion protein, it mediates the penetration of the viral nucleocapsid into the cell cytoplasm by fusing the endocytosed virus particle membrane with the endosomal membrane. The low pH within endosomes induces an irreversible conformational change in the protein, releasing a fusion hydrophobic peptide.
Protein Families
Novirhabdovirus glycoprotein family
Subcellular Location
Virion membrane; Single-pass type I membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
