Recombinant Influenza A virus Matrix protein 2 (M2)

Shipped with Ice Packs
In Stock

Description

Recombinant M2 in Vaccine Development

Recombinant M2e-based vaccines exploit the ectodomain's high conservation across influenza A subtypes.

Key Platforms and Findings:

  • Virus-like particles (VLPs): M2e fused to hepatitis B core (HBc) induced 100% protection in mice against lethal H5N1 challenge .

  • DNA vaccines: Full-length M2-DNA vaccines cross-protected against divergent strains, including H5N1 .

  • Plant-derived M2e: Transient expression in tobacco plants produced immunogenic M2e-Zera® fusion proteins .

Vaccine StrategyImmune ResponseEfficacy
M2e-flagellin conjugatesEnhanced IgG and mucosal IgA70% survival rate in ferrets
M2e-HA fusion proteinsBroad cross-reactivityReduced viral titers by 3–5 logs in mice
Monoclonal anti-M2e IgGFcγ receptor-dependent phagocytosisAccelerated recovery in human challenge studies

Clinical and Epidemiological Data

  • Seroprevalence: 47% of A(H1N1)pdm09-infected individuals developed anti-M2 antibodies cross-reactive with seasonal strains .

  • Age dependence: Anti-M2 seropositivity increases from 12% (children) to 58% (adults >50 years) .

Immune Dynamics:

  • Pre-existing M2 antibodies correlate with faster IgG recall responses post-infection .

  • M2-specific immunity reduces viral shedding but does not prevent infection .

Challenges in M2-Based Immunity

  • Low immunogenicity: Native M2e is shielded by HA/NA proteins in virions .

  • Non-sterilizing protection: Requires synergistic action with alveolar macrophages .

  • Viral countermeasures: M2 mutations (e.g., W15R) emerge under antibody pressure in vitro .

Future Directions

  1. Adjuvant optimization: TLR5 agonists boost M2e-specific antibody avidity .

  2. Multivalent designs: Combining M2e with conserved HA stalk antigens .

  3. Delivery systems: mRNA-LNP platforms expressing M2e-M1 fusion proteins .

Product Specs

Buffer
For liquid formulations, the storage buffer is Tris/PBS-based, containing 5-50% glycerol. Lyophilized powder is prepared using a Tris/PBS-based buffer containing 6% Trehalose before lyophilization.
Form
Available as Liquid or Lyophilized Powder
Note: We will prioritize shipping the available format. To specify your preferred format, please indicate this in your order notes. We will fulfill your request to the best of our ability.
Lead Time
3-7 business days
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized powder has a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tag and C-terminal Myc-tag
Synonyms
Proton channel protein M2
Datasheet & Coa
Please contact us to get it.
Expression Region
1-97aa
Mol. Weight
18.6kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Immunology
Source
in vitro E.coli expression system
Species
Influenza A virus
Target Names
M2
Target Protein Sequence
MSLLTEVETPTRSGWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKCIYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Q&A

What is the structure and function of Influenza A virus M2 protein?

The Influenza A virus M2 protein is a 97-amino-acid integral membrane protein that forms disulfide-linked tetramers. It consists of three domains: an N-terminal ectodomain (M2e) of 23 amino acids that extends outside the virion, a transmembrane domain that forms the proton channel, and a C-terminal cytoplasmic tail of 54 amino acids .

M2's primary function is as a proton channel, which allows for acidification of the virion interior during the entry process. This acidification is crucial for releasing viral ribonucleoproteins (vRNPs) from the matrix protein M1, enabling them to enter the host cell nucleus . The channel activity is the target of the antiviral drugs amantadine and rimantadine, although resistance to these medications has become widespread.

Beyond its ion channel function, M2 plays critical roles in virus assembly and budding. The C-terminal cytoplasmic tail is particularly important for these processes while having minimal effect on the proton channel activity . The membrane-distal region of this tail is essential for incorporating vRNPs into budding particles, while the membrane-proximal region can induce membrane curvature and has been implicated in ESCRT-independent membrane scission during viral budding .

How does M2 protein trafficking occur in polarized epithelial cells?

M2 protein is naturally targeted to the apical membrane of polarized epithelial cells, which is critical for proper influenza virus assembly and budding. In polarized epithelial cells (such as those lining the respiratory tract), M2 follows the secretory pathway through the endoplasmic reticulum and Golgi complex before reaching the apical plasma membrane .

Experimental evidence shows that altering M2's normal targeting significantly impacts viral replication. When M2 is artificially directed to the basolateral membrane (using a C-terminal AAASLLAP targeting motif) or retained in the endoplasmic reticulum (using a C-terminal KKXX motif), influenza virus replication is substantially reduced . Specifically, basolateral targeting of M2 reduces infectious virus titers with minimal effects on total virus particle release, while ER retention results in reduced production of both infectious virions and total virus particles .

These findings highlight the importance of proper M2 localization for the coordination of viral assembly. The interaction of viral proteins M2, M1, HA, and NA near glycolipid rafts in the apical plasma membrane is hypothesized to orchestrate the assembly of infectious virus particles . When M2 targeting is disrupted, this coordinated assembly process is compromised, leading to reduced viral replication efficiency.

What experimental systems are used to study M2 protein function?

Multiple experimental systems have been developed to study M2 protein function, each with specific advantages for investigating different aspects of M2 biology:

Cell Culture Systems:

  • MDCK II cells are frequently used for polarized epithelial cell studies and can be stably transfected to express wild-type or mutant M2 proteins .

  • Primary human nasal epithelial cell (hNEC) cultures provide a more physiologically relevant system for studying M2 function in the context of human infection .

  • Various other cell lines (HEK293T, A549) are used for basic expression studies and virus growth kinetics.

Viral Genetic Systems:

  • Reverse genetics systems allow the generation of recombinant viruses with specific mutations in the M2 gene or M2-deficient viruses (M2-stop viruses) that can be complemented by M2 expressed in trans .

  • These systems enable detailed structure-function analyses of M2 domains.

Biochemical and Biophysical Approaches:

  • Ion channel activity can be measured using electrophysiological techniques or fluorescence-based assays with pH-sensitive dyes.

  • Structural studies employ X-ray crystallography, NMR spectroscopy, and electron microscopy to determine M2 protein conformation.

Animal Models:

  • Mouse and ferret models are commonly used to evaluate the impact of M2 mutations on viral pathogenesis and transmission .

  • These models are also crucial for testing M2-based vaccine candidates before clinical trials .

Choosing the appropriate experimental system depends on the specific research question, with combinations of approaches often providing the most comprehensive insights into M2 function.

How can recombinant M2 protein be optimally expressed and purified for structural and functional studies?

Expressing and purifying functional recombinant M2 protein presents significant challenges due to its membrane-associated nature. Several methodological approaches have been optimized to overcome these challenges:

Expression Systems:

Purification Strategies:

  • Detergent solubilization: Carefully selected detergents (such as n-dodecyl β-D-maltoside, octyl glucoside, or DHPC) can extract M2 from membranes while maintaining its tetrameric structure and function.

  • Affinity chromatography: His-tagged or FLAG-tagged M2 constructs enable efficient purification using nickel or anti-FLAG affinity columns, respectively .

  • Size exclusion chromatography: This technique separates tetrameric M2 from aggregates and other oligomeric states.

Functional Validation:

  • Liposome reconstitution: Purified M2 can be incorporated into liposomes to verify proton channel activity using pH-sensitive dyes.

  • Circular dichroism spectroscopy: This technique confirms proper secondary structure.

  • Cross-linking studies: Chemical cross-linking followed by SDS-PAGE verifies the tetrameric assembly of M2.

For structural studies, additional considerations include protein stability in various buffer conditions and the presence of stabilizing ligands (such as amantadine analogues for structural studies of the transmembrane domain). Researchers should carefully optimize expression and purification conditions based on their specific experimental needs, with particular attention to maintaining the native tetrameric structure of M2.

What are the key considerations for developing M2e-based universal influenza vaccines?

Developing M2e-based universal influenza vaccines requires addressing several critical considerations that impact immunogenicity, efficacy, and clinical translation:

Antigen Design Strategies:

  • Carrier protein selection: Since M2e alone is poorly immunogenic (only 23 amino acids), it must be conjugated to carrier proteins or displayed on virus-like particles (VLPs). Multiple carriers have been explored, including:

    • Hepatitis B virus core (HBVc) VLPs

    • Papaya mosaic virus VLPs

    • Human papillomavirus VLPs

    • Phage Qβ-derived VLPs

    • Keyhole limpet hemocyanin

  • M2e sequence optimization: While M2e is relatively conserved, sequence variations exist between human and avian influenza strains (particularly at positions 11, 14, 16, and 20). Vaccines may include consensus M2e sequences or multiple M2e variants to broaden protection .

  • Multi-epitope approaches: Combining M2e with other conserved influenza antigens (like HA stalk domains) may enhance breadth of protection.

Immune Response Considerations:

  • Antibody effector mechanisms: Unlike neutralizing anti-HA antibodies, anti-M2e antibodies operate through different mechanisms. Protection correlates with:

    • FcγRIII-mediated effector functions

    • Elimination of infected cells via complement-mediated or NK cell-mediated killing

    • Phagocytosis of infected cells by macrophages

  • Route of administration: The immunization route significantly impacts protective efficacy:

    • Intranasal immunization induces stronger local airway-associated immunity (mucosal IgA) and can provide better protection against nasal challenge despite lower serum antibody levels

    • Parenteral immunization induces higher serum IgG levels but may be less effective against respiratory challenge

  • Adjuvant selection: Appropriate adjuvants are crucial for enhancing M2e immunogenicity and directing the desired immune response profile.

Clinical Translation Challenges:

  • Correlates of protection: Unlike conventional vaccines where hemagglutination-inhibitory antibody titers serve as correlates of protection, definitive correlates for M2e vaccines remain elusive and must be established through clinical efficacy studies .

  • Efficacy measurement: Since M2e-based vaccines aim to reduce disease severity rather than prevent infection entirely, clinical endpoints must be carefully defined.

  • Pre-existing immunity: Unlike conventional vaccines, M2e immunity is weak to non-existent after natural infection or conventional vaccination, requiring multiple immunizations to establish protective immunity .

Phase I clinical studies with M2e vaccine candidates have demonstrated safety and immunogenicity in humans, but efficacy studies remain necessary to validate this approach for pandemic and epidemic influenza control .

What mechanisms underlie the protective efficacy of anti-M2e antibodies?

Anti-M2e antibodies operate through distinct mechanisms compared to traditional neutralizing antibodies against hemagglutinin (HA). Understanding these mechanisms is crucial for vaccine development and evaluation:

Infected Cell Recognition vs. Virus Neutralization:
Unlike anti-HA antibodies that directly neutralize virions by blocking receptor binding, anti-M2e antibodies primarily target infected cells that express abundant M2 on their surface. These antibodies have limited direct neutralizing activity in standard in vitro neutralization assays .

Fc Receptor-Dependent Mechanisms:
The protective effect of anti-M2e antibodies relies heavily on Fc-mediated effector functions. Recent research has demonstrated that FcγRIII (CD16), an IgG-binding receptor present on multiple immune cells, plays a critical role in protection mediated by anti-M2e human monoclonal antibodies . This suggests the following mechanisms:

  • Antibody-Dependent Cellular Cytotoxicity (ADCC): NK cells recognize anti-M2e antibodies bound to infected cells via their FcγRIII receptors, leading to targeted killing of these cells.

  • Complement-Dependent Cytotoxicity (CDC): Anti-M2e antibodies bound to infected cells can activate the complement cascade, resulting in the formation of membrane attack complexes and cell lysis.

  • Antibody-Dependent Cellular Phagocytosis (ADCP): Macrophages and neutrophils recognize antibody-coated infected cells and eliminate them through phagocytosis .

These mechanisms collectively suppress viral replication by eliminating infected cells before they can produce and release new virions (Figure 3 in the reference) .

Epitope Specificity Considerations:
Interestingly, not all anti-M2e antibodies are equally protective. Following subcutaneous immunization with synthetic M2e conjugate vaccines, protection correlated specifically with antibodies recognizing native tetrameric M2 (approximately 15% of total anti-M2e serum IgGs) rather than with total anti-M2e antibody levels . This highlights the importance of antigen presentation format in vaccine design to elicit antibodies with optimal specificity.

Mucosal vs. Systemic Immunity:
The route of anti-M2e antibody delivery significantly impacts protective efficacy. Intranasal immunization provides better protection against respiratory challenge despite inducing lower serum antibody levels compared to parenteral routes. This suggests that local airway-associated immunity, including mucosal IgA and tissue-resident memory cells, plays a crucial role in the upper respiratory tract defense against influenza .

Understanding these complex protective mechanisms is essential for developing effective correlates of protection for M2e-based vaccines and designing optimal vaccination strategies.

How do M2 protein mutations affect antiviral drug resistance and vaccine efficacy?

The M2 protein's role in both antiviral drug susceptibility and as a vaccine target makes understanding its mutation patterns crucial for both therapeutic and preventive approaches:

Antiviral Drug Resistance:
The M2 proton channel is the target of adamantane class antiviral drugs (amantadine and rimantadine). Resistance to these drugs has emerged rapidly and is now widespread in circulating influenza strains. Key resistance mutations include:

  • S31N mutation: The most common resistance mutation globally, resulting in a conformational change that prevents drug binding while maintaining channel function.

  • V27A, L26F, and A30T mutations: Additional substitutions that confer adamantane resistance through altered drug binding sites.

These mutations typically occur in the transmembrane domain and affect drug binding without compromising the essential proton channel function, explaining their ready selection under drug pressure.

M2e Vaccine Escape Potential:
Despite high conservation of M2e across influenza A strains, potential for vaccine escape exists:

  • Experimental evidence: M2e-escape virus mutants have been isolated from severe combined immunodeficiency mice treated with anti-M2e monoclonal antibodies, demonstrating that escape can occur under immune pressure .

  • Natural variation: The typical sequence of avian M2e differs from human M2e by four amino acid residues at positions 11, 14, 16, and 20, which could affect cross-protection between human and avian strains .

  • Evolutionary constraints: Unlike HA and NA, M2e has not been subject to intense immune selection pressure in nature, as M2e-specific immunity after natural infection or conventional vaccination is weak to non-existent . This explains its high conservation but raises questions about potential drift under widespread M2e vaccine deployment.

Implications for Vaccine Design:
To address potential escape mutations, M2e-based vaccine strategies include:

  • Multiple M2e variant inclusion: Vaccines containing both human and avian M2e sequences can broaden protection against diverse strains.

  • Focusing on highly conserved regions: Targeting the most conserved portions of M2e that are functionally constrained.

  • Combination approaches: Including M2e alongside other conserved influenza antigens to create multiple barriers to escape.

What are the methodological approaches for studying M2 protein interactions with host factors during viral assembly?

Studying M2 protein interactions with host factors during viral assembly requires sophisticated methodological approaches that can capture dynamic protein-protein interactions in complex cellular environments:

Proximity-Based Labeling Techniques:

  • BioID/TurboID: By fusing M2 to a promiscuous biotin ligase (BirA* or TurboID), researchers can identify proteins that come into proximity with M2 during assembly. The biotin-labeled proteins can be purified using streptavidin and identified by mass spectrometry.

  • APEX2 proximity labeling: Similar to BioID but using an engineered peroxidase that catalyzes biotinylation of nearby proteins upon addition of biotin-phenol and H₂O₂. This approach offers temporal control for capturing interactions at specific stages of assembly.

Advanced Microscopy Approaches:

  • Super-resolution microscopy: Techniques such as STORM, PALM, or STED microscopy can visualize M2 co-localization with host factors at resolutions below the diffraction limit, revealing spatial organization at virus assembly sites.

  • Live-cell imaging: Fluorescently tagged M2 and host proteins can be tracked in real-time using spinning disk confocal microscopy to observe dynamic interactions during assembly.

  • Correlative light and electron microscopy (CLEM): This technique bridges the gap between fluorescence microscopy and electron microscopy, allowing visualization of M2-host factor interactions in the context of ultrastructural features of virus assembly.

Biochemical and Proteomics Approaches:

  • Co-immunoprecipitation coupled with mass spectrometry: Pull-down of M2 from infected or transfected cells followed by mass spectrometry analysis can identify interacting partners. Crosslinking prior to lysis can capture transient interactions.

  • Membrane flotation assays: These can separate membrane-associated protein complexes containing M2 and interacting partners based on density.

  • Split-reporter protein complementation assays: Techniques such as bimolecular fluorescence complementation (BiFC) or split-luciferase assays can validate specific M2-host protein interactions in living cells.

Genetic Approaches:

  • CRISPR/Cas9 screening: Genome-wide or targeted screens can identify host factors whose depletion affects M2 localization or function during assembly.

  • RNA interference: Targeted knockdown of candidate host factors can reveal their functional importance in M2-mediated assembly.

Functional Validation:

  • Viral budding assays: Quantification of virus-like particle (VLP) release when specific M2-host factor interactions are disrupted.

  • Electron microscopy of budding structures: Ultrastructural analysis of budding virions under conditions where M2-host interactions are altered.

  • Single-particle tracking: Analysis of M2 mobility in the plasma membrane in the presence or absence of specific host factors.

These complementary approaches can provide comprehensive insights into how M2 interacts with the host cell machinery during viral assembly, potentially revealing new targets for antiviral intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.