Recombinant Influenza A virus Matrix protein 2 (M2)-VLPs

Shipped with Ice Packs
In Stock

Description

Immunogenicity and Cross-Protective Efficacy

Key Findings from Preclinical Studies:

Study DesignResultsReference
Intranasal M2-VLP immunization (mice)- IgG2a-dominant antibodies persisted for 7 months post-boost. Cross-reactivity with H1N1, H3N2, H5N1, and 2009 H1N1 viruses .
M2-VLPs + TLR7/8 ligand RNAEnhanced IgG subclass switching (IgG2a/IgG1 ratio >3) compared to eukaryotic RNA-containing VLPs .
Heterosubtypic challenge (H3N2)4-fold reduction in lung viral titers; 100% survival rate .

Mechanisms of Protection:

  • Antibody-Mediated Opsonization: M2-specific IgG2a promotes Fc receptor-dependent phagocytosis by macrophages and dendritic cells .

  • Mucosal Immunity: Significant IgA responses in bronchoalveolar lavage fluid (BALF) correlate with reduced viral replication .

  • T Cell Activation: M2-VLPs elicit CD4+ T cell responses, augmenting antibody longevity .

Advantages Over Conventional M2e Vaccines

Comparison of M2e Vaccine Platforms:

PlatformAdjuvant RequiredCross-ProtectionDurabilityReference
M2e-Qβ bacteriophage VLPsYesModerate6 months
M2e-GCN4 conjugatesYesHigh4 months
M2-VLPsNoHigh>7 months

M2-VLPs eliminate the need for adjuvants and induce broader, longer-lasting immunity due to their particulate nature and multivalent M2e display .

Challenges and Optimization Strategies

Limitations:

  • Low Native Immunogenicity: M2e is poorly immunogenic during natural infection due to steric masking by hemagglutinin (HA) .

  • Strain-Specific Antibody Interference: Pre-existing anti-HA antibodies may block M2e accessibility .

Engineering Solutions:

  • Multimerization: Displaying M2e in tandem repeats (e.g., 5xM2e-VLPs) enhances antibody avidity .

  • Combination Vaccines: Co-administering M2-VLPs with HA/NA-VLPs improves coverage against seasonal and pandemic strains .

Clinical and Industrial Relevance

Production Systems:

  • E. coli: Cost-effective for M2e peptide synthesis but lacks post-translational modifications .

  • Baculovirus/Insect Cells: Scalable for full-length M2-VLP production with proper membrane anchoring .

Product Specs

Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4
Form
Lyophilized powder
Note: We will default ship it in lyophilized form with normal blue ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice. Please communicate with us in advance as extra fees for dry ice and a dry ice box will be charged.
Lead Time
Delivery time may differ depending on the purchasing method or location. Please kindly consult your local distributors for specific delivery times.
Note: Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery times.
Notes
Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receiving it. It is crucial to avoid repeated freezing and thawing, as this can affect the protein's activity.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
C-terminal 10xHis-tagged
If you have a specific tag type in mind, please inform us, and we will investigate the feasibility of its development.
Synonyms
Proton channel protein M2
Datasheet & Coa
Please contact us to get it.
Expression Region
1-97aa
Research Area
Immunology
Source
Mammalian cell
Species
Influenza A virus
Target Names
M2
Target Protein Sequence
MSLLTEVETPTRSGWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKCIYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Q&A

What is the M2 protein and why is the M2e domain considered a universal influenza vaccine candidate?

The matrix protein 2 (M2) is an essential influenza A virus protein that fulfills at least three critical functions in the viral life cycle. First, its ion channel activity enables proton flux into the virion interior in the acidic environment of endosomes, which weakens interactions between matrix protein 1 and viral ribonucleoproteins within the viral core. Second, M2 is required for virus assembly and budding through interactions with M1 and by altering membrane curvature. Third, M2 perturbs several host cell functions including inflammasome activation and autophagy interference .

The M2 ectodomain (M2e) is the 23-amino-acid N-terminal portion that protrudes from the viral membrane. M2e is highly conserved across all influenza A virus subtypes, making it an attractive universal vaccine candidate. Unlike conventional influenza vaccines that target highly variable regions, M2e-based vaccines can potentially provide protection against any influenza A virus challenge, including pandemic strains .

How do M2e-VLPs differ from traditional influenza vaccines in terms of protective mechanisms?

Traditional influenza vaccines primarily induce neutralizing antibodies against hemagglutinin (HA), providing strain-specific protection that becomes ineffective when the virus undergoes antigenic drift or shift. In contrast, M2e-VLPs operate through different immune mechanisms.

M2e-based immunity is largely accomplished by IgG antibodies that do not offer sterilizing immunity (complete prevention of infection). Instead, M2e-specific antibodies work through Fcγ receptor-mediated effector mechanisms, likely in concert with alveolar macrophages. These mechanisms include antibody-dependent cell cytotoxicity (ADCC) and potentially other Fc-mediated functions that eliminate infected cells rather than preventing initial infection .

This non-neutralizing but protective immunity can reduce virus replication and disease severity associated with influenza A virus infection, potentially protecting against any influenza A virus subtype due to the high conservation of the M2e sequence .

What expression systems are commonly used for producing M2e-VLPs, and what are their comparative advantages?

Recombinant M2e-VLPs can be produced using various expression systems, each with distinct advantages and limitations:

The choice of expression system depends on the specific requirements for M2e-VLP folding, PTMs, yield requirements, and cost considerations for the intended research or clinical application .

What are the optimal methods for characterizing the physical and structural attributes of M2e-VLPs?

Comprehensive characterization of M2e-VLPs requires multiple complementary techniques to assess various Critical Quality Attributes (CQAs):

These methods together provide a comprehensive profile of M2e-VLP physical attributes that correlate with immunogenicity and stability, critical for developing consistent products for preclinical and clinical evaluation .

How can researchers optimize M2e-VLP production and assembly in different expression systems?

Optimizing M2e-VLP production requires careful consideration of several process parameters:

  • Expression Vector Design: For M2e-VLPs, optimization often involves creating constructs that enhance expression and self-assembly. This may include codon optimization for the host system, addition of signal peptides for proper targeting, and fusion to carrier proteins that promote VLP formation .

  • Culture Mode Selection: Three main culture modes can be employed:

    • Batch cultivation: Simplest approach with lower risk of contamination, but often yields lower productivity

    • Fed-batch cultivation: Provides higher yields by controlled nutrient feeding

    • Continuous cultivation: Offers sustained production but with increased complexity

  • Process Parameter Control: Critical parameters must be optimized and monitored:

    • Dissolved oxygen concentration: Both limited and excess oxygen can be detrimental, potentially inducing proteases or causing oxidative damage

    • Temperature: Affects oxygen solubility, protein folding, and cell metabolism

    • pH: Influences protein stability and cellular function

    • Agitation rate: Impacts oxygen transfer but can cause shear stress

  • Assembly Conditions: For some VLPs, expression and assembly can be separated processes. Cell-free assembly conditions (pH, ionic strength, reducing environment) can be optimized to improve proper M2e presentation on VLP surfaces .

  • In-Process Monitoring: Real-time monitoring techniques allow for adjustments during production. For example, in situ monitoring of VLP formation kinetics can help determine optimal harvest times .

Each expression system requires specific optimization strategies. For M2e-VLPs, considerations include ensuring proper folding of the highly conserved ectodomain and achieving the desired presentation of multiple M2e copies on the VLP surface to maximize immunogenicity .

What immunological assays are most appropriate for evaluating M2e-VLP efficacy in preclinical studies?

Evaluating M2e-VLP efficacy requires comprehensive assessment of both humoral and cellular immune responses, as well as protection against viral challenge:

  • Antibody Response Measurement:

    • Anti-M2e antibody titers: ELISA to quantify IgG, IgA, and other isotypes specific to M2e

    • Antibody avidity assays: To assess the strength of antibody binding to M2e

    • Functional antibody assays: Including Fc receptor binding assays, as M2e protection relies on Fcγ receptor-mediated effector mechanisms

  • Cellular Immune Response Assessment:

    • T cell proliferation assays: To measure antigen-specific T cell responses

    • Cytokine profiling: ELISpot or intracellular cytokine staining to characterize T helper cell responses (Th1/Th2 balance)

    • CD8+ T cell activity: Particularly important as M2e DNA vaccines have shown induction of both humoral and cellular immunity

  • Protection Evaluation:

    • Viral challenge studies: Using homologous and heterologous influenza virus strains to assess cross-protection

    • Viral load measurement: In respiratory tissues (lungs, nasal passages) to determine reduction in viral replication

    • Clinical scoring: For disease severity assessment

    • Survival rates: Particularly in mouse models, as demonstrated in studies of M2e DNA vaccines

  • Mechanism Investigation:

    • Adoptive transfer experiments: To determine the role of antibodies versus T cells

    • Studies in Fc receptor knockout mice: To confirm the role of Fcγ receptor-mediated effector mechanisms

    • Alveolar macrophage depletion studies: To assess their role in M2e-mediated protection

These assays should be performed in appropriate animal models, with mice being the most common but additional studies in natural influenza A virus hosts providing more translational value. The collective data from these assays helps establish the immunological correlates of protection for M2e-VLP vaccines .

How do M2e sequence variations across different influenza A subtypes affect cross-protective immunity of M2e-VLPs?

Despite the high conservation of M2e across influenza A viruses, subtle sequence variations do exist, particularly between human and avian strains. These variations can influence the breadth of protection offered by M2e-VLPs:

The first 9 amino acid residues of M2e are almost invariant across all influenza A viruses due to overlapping genomic constraints. This region contains a packaging signal for viral RNA segment 7 and the beginning of open reading frames for both M1 and M2 proteins, as well as the splice donor for the M2 transcript. This explains the extreme conservation of this region .

To address this challenge, advanced M2e-VLP designs often incorporate multiple M2e variants (human, avian, and swine) on a single VLP scaffold. This approach creates a broader immune response capable of recognizing diverse M2e sequences. Studies with such multi-M2e constructs have shown enhanced cross-protection against divergent influenza A virus strains compared to single M2e constructs .

Additionally, strategic mutations in M2e sequences can be introduced to enhance immunogenicity while maintaining cross-reactivity. Research on optimized M2e DNA vaccines has demonstrated that such modifications can improve both humoral and cellular immune responses while maintaining protection against heterologous viruses .

What is the mechanistic basis for Fcγ receptor-mediated protection by M2e-specific antibodies?

The protective mechanism of M2e-specific antibodies differs fundamentally from traditional neutralizing antibodies against hemagglutinin. This non-neutralizing but protective immunity operates through several interconnected mechanisms:

When M2e-specific antibodies bind to infected cells, they recruit effector cells through interactions with Fcγ receptors. These effector cells, primarily alveolar macrophages, can then eliminate the infected cells through several mechanisms:

  • Antibody-Dependent Cell-mediated Cytotoxicity (ADCC): Natural killer cells and macrophages recognize antibody-coated infected cells through their Fcγ receptors and induce apoptosis of these cells, limiting viral spread. Studies with Fc receptor knockout mice have confirmed the essential role of this pathway in M2e-mediated protection .

  • Antibody-Dependent Cellular Phagocytosis (ADCP): Macrophages can phagocytose antibody-coated infected cells, again limiting viral replication and spread.

  • Complement Activation: M2e-specific antibodies may also activate complement, contributing to the elimination of infected cells.

The relative contribution of these mechanisms may vary depending on the specific properties of the antibodies induced by vaccination, including their isotype, affinity, and glycosylation patterns. Most studies indicate that IgG2a antibodies (in mice) are particularly important for M2e-mediated protection, consistent with their strong binding to activating Fcγ receptors .

These mechanisms explain why M2e-based immunity does not prevent infection but can significantly reduce viral replication and disease severity, potentially providing broad protection against diverse influenza A viruses .

How do different VLP platforms affect the immunogenicity and efficacy of M2e presentation?

The choice of VLP platform significantly impacts M2e immunogenicity through differences in size, structure, stability, and epitope presentation:

  • Hepatitis B Virus Core (HBc) VLPs: One of the most widely used platforms for M2e presentation. The immunodominant loop of HBc provides an excellent insertion site for M2e, resulting in dense, repetitive display of the antigen. HBc VLPs are highly immunogenic and can be produced in various expression systems including E. coli. Multiple M2e copies can be inserted into a single HBc monomer, further enhancing immunogenicity .

  • Bacteriophage Qβ VLPs: These provide a rigid scaffold for M2e display and can be chemically conjugated with M2e peptides rather than requiring genetic fusion. This approach allows precise control over the density and orientation of M2e epitopes on the VLP surface .

  • Plant Virus-derived VLPs: Platforms such as tobacco mosaic virus (TMV) and papaya mosaic virus (PapMV) have been used to display M2e. These systems offer the advantages of plant-based expression, including cost-effectiveness and scalability .

  • Influenza VLPs: Using the influenza virus matrix protein (M1) as the core, with M2e either in its natural context or engineered for increased density. These VLPs more closely mimic the native virus structure but may require more complex expression systems like insect or mammalian cells .

Key factors affecting M2e-VLP immunogenicity include:

  • Epitope Density: Higher density of M2e epitopes generally correlates with stronger antibody responses

  • Epitope Orientation: Proper presentation of M2e in its native conformation enhances the quality of antibody responses

  • VLP Size and Stability: Particles in the 20-200 nm range are optimally taken up by antigen-presenting cells

  • Adjuvant Compatibility: Different VLP platforms may synergize differently with various adjuvants

Comparative studies have shown that the same M2e sequence can elicit dramatically different immune responses depending on the VLP platform used for presentation. Therefore, platform selection should be considered a critical design element in M2e-VLP vaccine development .

What are the major technical challenges in scaling up M2e-VLP production for clinical studies?

Scaling up M2e-VLP production from laboratory to clinical scale presents several technical challenges that must be addressed:

  • Process Consistency and Reproducibility: Ensuring batch-to-batch consistency is critical for clinical material. VLP assembly is influenced by numerous factors including protein concentration, pH, ionic strength, and temperature. Small variations in these parameters during scale-up can significantly affect VLP quality. Implementing robust in-process controls and monitoring systems is essential .

  • Production Mode Optimization: While batch cultivation is simpler, it often results in lower productivity due to substrate limitation and waste accumulation. Fed-batch and continuous cultivation systems can improve yields but add complexity to the process. Each production mode must be evaluated for its impact on M2e-VLP quality attributes .

  • Oxygen Transfer and Shear Stress: In larger bioreactors, maintaining adequate dissolved oxygen levels becomes challenging. Excessive bubbling or agitation can cause damaging shear stress to cells and proteins. Solutions include:

    • Headspace aeration (bubble-free systems)

    • Use of nonionic copolymers to increase cell resistance to hydrodynamic forces

    • Optimized impeller designs

  • Purification Scalability: Downstream processing must be adapted for larger volumes while maintaining purity and recovery. Chromatographic methods that work well at laboratory scale may face flow rate limitations and resin compression at production scale. Development of efficient, scalable purification trains is critical .

  • Stability During Processing and Storage: M2e-VLPs must maintain structural integrity and epitope presentation throughout manufacturing and storage. This requires careful formulation development and stability studies under various conditions .

  • Analytical Method Scalability: Methods used to characterize M2e-VLPs at research scale (e.g., TEM, Cryo-EM) may not be practical for routine batch testing at production scale. Development of high-throughput analytical methods that correlate with key quality attributes is necessary .

Addressing these challenges requires systematic process development with quality by design principles, where critical process parameters are identified and controlled to ensure consistent M2e-VLP critical quality attributes throughout scale-up .

How can researchers enhance the limited immunogenicity of M2e while maintaining its cross-protective potential?

Despite its high conservation, M2e exhibits limited inherent immunogenicity, which researchers have addressed through several innovative approaches:

These approaches have demonstrated significant enhancement of M2e immunogenicity in preclinical models, with some combinations showing protection comparable to that of conventional influenza vaccines but with the added benefit of cross-protection against diverse virus strains .

What are the latest advances in combining M2e with other conserved influenza antigens in universal vaccine approaches?

Recent research has focused on combining M2e with other conserved influenza antigens to create more comprehensive universal vaccine candidates:

  • M2e and HA Stem Combinations: The highly conserved hemagglutinin stem (stalk) region contains epitopes that, like M2e, can provide broad protection. Several advanced approaches now combine M2e with HA stem domains:

    • Chimeric VLPs displaying both M2e and the conserved long α-helix (LAH) domain of HA2

    • Mosaic particles with M2e and headless HA constructs

    • Nucleic acid vaccines encoding both antigens

  • Multi-Component mRNA Platforms: Recent advances in nucleoside-modified mRNA technology have enabled the development of multi-antigen approaches. Studies have shown that nucleoside-modified mRNA-lipid nanoparticles (LNPs) expressing multiple conserved antigens, potentially including M2e, can provide broad protection against diverse influenza viruses .

  • Nucleic Acid-Based Approaches: DNA and mRNA vaccines encoding M2e have demonstrated significant immunogenicity and protection in animal models. An optimized M2e DNA vaccine induced both humoral and cellular immune responses and provided protection against both homologous and heterologous influenza viruses. These platforms allow for easy combination with other conserved antigens .

  • M2e and Nucleoprotein (NP) Combinations: NP is another highly conserved internal protein that primarily elicits T-cell responses. Vaccines combining M2e (driving antibody responses) with NP (driving T-cell responses) can create complementary immune mechanisms for enhanced protection .

  • Recombinant Viral Vectors: Viral vectors expressing multiple conserved antigens, including M2e, HA stem, and internal proteins, have shown promise in preclinical studies. These approaches benefit from the intrinsic immunogenicity of the vector while delivering multiple antigens .

  • Nanoparticle Platforms: Self-assembling protein nanoparticles can display M2e along with other conserved epitopes in defined orientations and densities, potentially optimizing immune responses to each component .

These combination approaches aim to engage multiple arms of the immune system (antibody and T-cell responses) and target different viral components simultaneously, potentially overcoming viral escape mechanisms and providing truly universal protection against seasonal and pandemic influenza threats .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.