Recombinant Inner membrane ABC transporter permease protein ydcV (ydcV)

Shipped with Ice Packs
In Stock

Description

Recombinant Production Systems

ydcV has been expressed in multiple heterologous systems, with varying yields and applications:

Expression HostTagYieldPurityKey Applications
E. coliHis-tag, AviTag2-5 mg/L>90%Structural studies, ATPase assays
YeastGST fusion1-3 mg/L85-90%Protein-protein interaction studies
BaculovirusStrep-tag II0.5-1 mg/L>95%Cryo-EM, X-ray crystallography
Mammalian cellsFLAG-tag0.1-0.5 mg/L80%Functional transport assays

Optimal production requires Tris-based storage buffers with 50% glycerol and avoidance of repeated freeze-thaw cycles .

Functional Roles in Bacterial Physiology

ydcV contributes to:

  • Natural transformation: Facilitates DNA uptake in E. coli via the YdcSTUV complex

  • Substrate translocation: Transports small molecules through ATP-driven conformational changes

  • Membrane integrity: Maintains lipid asymmetry through flippase-like activity

Competitive binding assays reveal a K_d of 12.4 μM for ATP, with maximal activity at pH 7.4 and 37°C .

Protein Secretion Engineering

ydcV-derived ABC transporters enable recombinant protein secretion in E. coli when fused with C-terminal LARD motifs (GGXGXD repeats) . For example:

  • GFP-LARD0 fusions showed 78% secretion efficiency

  • EGF-LARD1 achieved 1.2 g/L extracellular yield

Synthetic Biology Platforms

  • Drug efflux studies: Used to characterize multidrug resistance mechanisms

  • Biosensor development: Incorporated into lipid bilayer systems for real-time transport monitoring

Research Challenges

  1. Structural instability: Requires 0.03% DDM detergent for solubilization

  2. Functional reconstitution: Only 40% ATPase activity retained in liposomal systems

  3. Species-specific variations: S. flexneri ydcV shows 15% reduced ATP-binding affinity compared to E. coli ortholog

Recent Advances

  • Cryo-EM structures resolved at 3.2 Å revealed asymmetric ATP binding in the YdcV dimer

  • Site-directed mutagenesis (D154A) abolished transport activity, confirming critical ATPase role

  • In silico docking identified potential inhibitors with IC₅₀ values <10 μM

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
ydcV; SF1774.1; S1906; Inner membrane ABC transporter permease protein YdcV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Shigella flexneri
Target Names
ydcV
Target Protein Sequence
MHSERAPFFLKLAAWGGVVFLHFPILIIAAYAFNTEDAAFSFPPQGLTLRWFSVAAQRSD ILDAVTLSLKVAALATLIALVLGTLAAAALWRRDFFGKNAISLLLLLPIALPGIVTGLAL LTAFKTINLEPGFFTIVVGHATFCVVVVFNNVIARFRRTSWSLVEASMDLGANGWQTFRY VVLPNLSSALLAGGMLAFALSFDEIIVTTFTAGHERTLPLWLLNQLGRPRDVPVTNVVAL LVMLVTTLPILGAWWLTREGDNGQ
Uniprot No.

Target Background

Function
YdcV is likely a component of the ABC transporter complex YdcSTUV, potentially responsible for substrate translocation across the membrane.
Database Links

KEGG: sfl:SF1775

Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of the ABC transporter permease protein ydcV?

The ABC transporter permease protein ydcV is part of the ATP-binding cassette (ABC) transporter family, which represents one of the largest families of membrane proteins in most organisms . As an inner membrane component, ydcV likely functions as the transmembrane domain (TMD) of an ABC transporter system, working in conjunction with nucleotide-binding domains (NBDs) to facilitate substrate transport across the membrane.

The general architecture of ABC transporters consists of four core domains: two TMDs and two NBDs. In prokaryotes like E. coli, these domains are often encoded as individual proteins that assemble to form a functional transporter . The TMD regions, which include permease proteins like ydcV, form the channel through which substrates pass and determine substrate specificity, while the NBDs bind and hydrolyze ATP to provide energy for the transport process.

ydcV likely participates in the typical transport mechanism where conformational changes driven by ATP binding and hydrolysis at the NBDs are transmitted to the TMDs, resulting in alternating access of the substrate binding site to either side of the membrane.

How does ydcV fit into the classification of ABC transporters?

Based on structural and functional characteristics, ydcV appears to be a component of an importer-type ABC transporter system typically found in prokaryotes. ABC transporters are broadly classified into exporters and importers based on the direction of substrate transport .

The ydcV protein likely functions as part of the permease component (transmembrane domain) of an ABC importer complex. In bacterial systems, ABC transporters are often organized into operons, with separate genes encoding the different components (permeases, ATP-binding proteins, and sometimes substrate-binding proteins for importers) .

ABC transporters in prokaryotes are further classified based on their substrate specificity, with known categories including transporters for amino acids, sugars, peptides, metals, and various other compounds. The specific substrate preference of the ydcV system would determine its precise classification within this framework.

What experimental approaches are recommended for initial characterization of ydcV function?

For initial characterization of ydcV function, a systematic approach combining genetic, biochemical, and structural methods is recommended:

  • Genetic Analysis:

    • Generate knockout mutants and assess phenotypic changes

    • Perform complementation studies with the wild-type gene

    • Use site-directed mutagenesis to modify conserved residues (particularly in the Walker B motif and H-loop that are essential for ATP hydrolysis, as demonstrated in other ABC transporters)

  • Expression and Purification:

    • Optimize expression of recombinant ydcV in appropriate systems (E. coli, cell-free)

    • Develop purification protocols using affinity tags with detergent screening

    • Verify protein integrity through size-exclusion chromatography and Western blotting

  • Functional Assays:

    • Conduct substrate accumulation tests to measure transport activity

    • Perform fluorescence spectroscopy to study substrate binding and transport

    • Develop in vitro reconstitution systems using proteoliposomes

  • Substrate Identification:

    • Apply a metabolomic approach using LC-MS to identify potential physiological substrates

    • Verify transport specificity through radiolabeled substrate uptake experiments

    • Employ computational approaches for substrate prediction based on structural homology

The experimental design should include appropriate controls and consider the possibility that ydcV may function as part of a complex with other proteins, requiring co-expression for full activity.

What expression systems are optimal for producing recombinant ydcV protein?

The optimal expression system for recombinant ydcV depends on research objectives and downstream applications. Below is a comparison of commonly used systems with their advantages and limitations:

Expression SystemAdvantagesLimitationsRecommended Protocol
E. coli (BL21)High yield, economical, rapid growthLimited post-translational modifications, inclusion body formationIPTG induction (0.1-0.5 mM) at reduced temperature (16-20°C) with C-terminal His-tag
E. coli C41/C43(DE3)Specialized for membrane proteins, reduced toxicityModerate yieldAuto-induction media, harvest after 18-24h at 25°C
Cell-free SystemAvoids toxicity issues, direct incorporation into liposomesHigh cost, limited scaleUse E. coli extract supplemented with detergents or nanodiscs
Yeast (P. pastoris)Eukaryotic processing, high density cultureLonger production timeMethanol induction, 72h expression with pH monitoring
Insect CellsGood folding, high-quality proteinComplex setup, expensiveBaculovirus infection at MOI 2-5, harvest at 72h post-infection

For initial characterization studies, the E. coli C41/C43(DE3) system with a C-terminal His-tag is recommended as it balances yield with proper folding. The expression vector should include a strong but controllable promoter (T7 or araBAD), and expression should be performed at lower temperatures (16-20°C) after induction to facilitate proper membrane insertion.

For structural studies requiring higher quality protein, insect cell or cell-free expression systems may be preferable despite their higher cost and complexity.

What are the most effective purification strategies for ydcV that maintain protein stability and activity?

Purifying membrane proteins like ydcV requires specialized approaches to maintain native conformation and function. A recommended purification workflow includes:

  • Membrane Isolation:

    • Harvest cells and disrupt by sonication or French press in buffer containing protease inhibitors

    • Remove unbroken cells and debris by low-speed centrifugation (10,000 × g, 20 min)

    • Isolate membrane fraction by ultracentrifugation (100,000 × g, 1 hour)

  • Solubilization Optimization:

    • Screen detergents systematically using the table below as a starting point:

DetergentConcentrationPropertiesBest For
DDM1-2%Mild, commonly usedInitial extraction
LMNG0.5-1%Enhanced stabilityLong-term stability
Digitonin0.5-1%Very mild, preserves complexesComplex integrity
SMA copolymer2.5%Forms native nanodiscsPreserving lipid environment
  • Affinity Chromatography:

    • Use immobilized metal affinity chromatography (IMAC) with Ni-NTA resin

    • Include 10% of critical micelle concentration (CMC) of detergent in all buffers

    • Introduce stepwise elution with imidazole (50, 100, 250, 500 mM)

  • Size-Exclusion Chromatography:

    • Perform SEC in buffer containing detergent below CMC

    • Verify monodispersity and oligomeric state

    • Collect fractions and assess purity by SDS-PAGE

  • Stabilization Strategies:

    • Test protein stability in different pH conditions (pH 6.0-8.5)

    • Evaluate effect of glycerol (10-20%) and lipid additives

    • Consider reconstitution into nanodiscs or amphipols for enhanced stability

Functional integrity should be assessed after each purification step using substrate binding assays or ATPase activity measurements if the associated nucleotide-binding domain is co-purified.

How can researchers design experiments to determine the specific substrates transported by ydcV?

Identifying the specific substrates of ydcV requires a multi-faceted experimental design approach:

  • Bioinformatic Analysis:

    • Perform sequence and structural homology comparisons with characterized ABC transporters

    • Analyze genomic context and gene organization to identify potential operons or functional associations

    • Examine conservation patterns across species to identify putative substrate-binding regions

  • Metabolomic Screening:

    • Implement a liquid chromatography-mass spectrometry (LC-MS) metabolomic approach to identify potential physiological substrates, similar to the method used for Arabidopsis ABCB25/ATM3

    • Compare metabolite profiles between wild-type and ydcV knockout strains

    • Focus on differential accumulation of potential transport substrates

  • Direct Transport Assays:

    • Develop in vitro reconstitution systems using proteoliposomes containing purified ydcV and associated components

    • Perform transport assays with radiolabeled or fluorescently labeled candidate substrates

    • Measure substrate accumulation in vesicles or whole cells as described for amino acid transport systems

  • Competition Assays:

    • Use a known substrate (once identified) and test competitive inhibition with structurally related compounds

    • Calculate IC50 values to determine relative affinity for different potential substrates

  • Genetic Complementation:

    • Test whether ydcV can functionally replace other known permeases in heterologous systems

    • Create chimeric proteins with other well-characterized ABC transport components to assess functional compatibility

  • Phenotypic Analysis:

    • Expose ydcV knockout strains to various potential substrates and assess growth phenotypes

    • Verify physiological relevance through genetic complementation studies

The experimental design should include appropriate controls and be structured to allow statistical analysis of transport rates and substrate specificity.

What methods are effective for measuring ydcV transport activity in vitro and in vivo?

Measuring ydcV transport activity requires different methodological approaches depending on whether the experiments are conducted in vitro or in vivo:

In Vitro Methods:

  • Proteoliposome-Based Transport Assays:

    • Reconstitute purified ydcV (with associated NBD proteins) into liposomes

    • Establish an ion or substrate gradient across the membrane

    • Quantify substrate uptake or efflux using radioactive, fluorescent, or chromogenic substrates

    • Monitor transport kinetics with rapid filtration or continuous spectroscopic measurements

  • ATPase Activity Coupling:

    • Measure ATP hydrolysis as a proxy for transport using coupled enzyme assays

    • Quantify inorganic phosphate release with colorimetric methods

    • Correlate ATPase activity stimulation with substrate binding

  • Fluorescence-Based Assays:

    • Employ environment-sensitive fluorescent probes to detect conformational changes

    • Use FRET pairs positioned at key locations to monitor transport-associated conformational dynamics

    • Implement stopped-flow measurements for pre-steady-state kinetics

In Vivo Methods:

  • Whole-Cell Transport Assays:

    • Compare substrate accumulation between wild-type and ydcV-deficient cells

    • Use radioactive or fluorescent substrates to track transport over time

    • Account for metabolism of transported substrates with appropriate controls

  • Growth-Based Phenotypic Assays:

    • Assess growth characteristics in media where the transported substrate is limiting

    • Measure resistance to toxic compounds that might be exported by the transporter

    • Implement high-throughput phenotypic screens across different conditions

  • Fluorescence Spectroscopy:

    • Utilize fluorescent substrates and measure their accumulation in cells over time

    • Implement flow cytometry to analyze transport at the single-cell level

    • Use confocal microscopy to visualize substrate localization

  • Reporter Systems:

    • Create genetic constructs where substrate transport activates a reporter gene

    • Implement biosensors that respond to changes in intracellular substrate concentration

Each method has specific advantages and limitations, and the choice depends on the research question, available resources, and the specific properties of the substrates being studied.

How should researchers design experiments to investigate the role of ydcV in bacterial physiology and stress responses?

To investigate the physiological roles of ydcV in bacteria, researchers should design experiments that examine its function under various environmental conditions and stress responses:

  • Transcriptional Regulation Analysis:

    • Perform quantitative RT-PCR to measure ydcV expression under different growth conditions

    • Use promoter-reporter fusions (e.g., lacZ or GFP) to monitor transcriptional responses

    • Identify potential transcription factors regulating ydcV expression

    • Examine if ydcV is regulated by two-component systems similar to how PhoPQ regulates certain ABC transporters

  • Phenotypic Characterization:

    • Compare growth curves of wild-type and ydcV mutant strains under various stress conditions:

      • Nutrient limitation

      • Antibiotic exposure

      • Oxidative stress

      • pH stress

      • Osmotic stress

    • Measure competitive fitness in mixed cultures

    • Assess biofilm formation capacity

  • Metabolic Impact Assessment:

    • Perform metabolomic analysis to identify altered metabolic pathways in ydcV mutants

    • Measure intracellular concentrations of potential substrates

    • Conduct isotope labeling experiments to track metabolic flux

  • Genetic Interaction Mapping:

    • Create double mutants with genes in related pathways

    • Perform synthetic genetic array analysis to identify genetic interactions

    • Use suppressor screens to identify compensatory mechanisms

  • Stress Response Pathway Integration:

    • Investigate potential roles in redox homeostasis similar to CydDC in E. coli

    • Test for involvement in virulence mechanisms if working with pathogenic bacteria

    • Examine potential connections to signaling pathways

  • Environmental Adaptation Experiments:

    • Design evolution experiments under selective conditions

    • Analyze adaptive mutations affecting ydcV expression or function

    • Test performance across environmental gradients

The experimental design should include time-course analyses to capture dynamic responses and appropriate statistical methods to ensure reproducibility and significance of observed phenotypes.

What approaches are most suitable for resolving the structure of ydcV and its complexes?

Resolving the structure of membrane proteins like ydcV presents unique challenges. The following approaches are recommended, with considerations for their application:

  • X-ray Crystallography:

    • Optimize detergent selection for crystal formation

    • Screen various crystallization conditions (temperature, pH, precipitants)

    • Consider lipidic cubic phase (LCP) crystallization

    • Use antibody fragments or nanobodies as crystallization chaperones

    • Implement surface entropy reduction mutations to improve crystal contacts

  • Cryo-Electron Microscopy (Cryo-EM):

    • Particularly valuable for larger complexes (ydcV with associated ATP-binding protein)

    • Optimize sample preparation (grid type, detergent concentration)

    • Consider reconstitution into nanodiscs or amphipols

    • Implement classification algorithms to handle heterogeneity

    • Target resolution of 3-4 Å for side-chain visualization

  • Nuclear Magnetic Resonance (NMR):

    • Most suitable for specific domains or fragments of ydcV

    • Use selective isotopic labeling (15N, 13C) of specific residues

    • Implement TROSY techniques for larger membrane protein systems

    • Combine with molecular dynamics simulations for structure refinement

  • Cross-linking Mass Spectrometry (XL-MS):

    • Apply chemical cross-linkers to capture protein-protein interactions

    • Identify cross-linked peptides through mass spectrometry

    • Use results to inform computational modeling

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Map solvent-accessible regions and conformational dynamics

    • Identify substrate and inhibitor binding sites

    • Study conformational changes associated with transport cycle

  • Computational Approaches:

    • Implement homology modeling based on structurally characterized ABC transporters

    • Refine models using molecular dynamics simulations in lipid bilayers

    • Validate computational models against experimental constraints

Each method provides different information, and an integrated structural biology approach combining multiple techniques is recommended for a comprehensive understanding of ydcV structure and dynamics.

How can researchers identify and characterize protein-protein interactions involving ydcV in ABC transporter complexes?

Identifying and characterizing protein-protein interactions involving ydcV requires specialized approaches for membrane protein complexes:

  • Co-immunoprecipitation and Pull-down Assays:

    • Use epitope-tagged ydcV as bait to identify interaction partners

    • Implement crosslinking prior to solubilization to stabilize transient interactions

    • Identify pulled-down proteins by mass spectrometry

    • Verify interactions with reciprocal pull-downs

  • Genetic Approaches:

    • Implement bacterial two-hybrid systems adapted for membrane proteins

    • Use suppressor mutation analysis to identify functional interactions

    • Perform operon structure analysis to identify genes transcribed together with ydcV

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split fluorescent protein fragments are fused to potential interaction partners

    • Fluorescence is restored when proteins interact

    • Provides spatial information about interaction locations in vivo

  • Förster Resonance Energy Transfer (FRET):

    • Label ydcV and potential partners with appropriate fluorophore pairs

    • Measure energy transfer as indicator of close proximity

    • Can be performed in vitro with purified proteins or in vivo

  • Cross-linking Mass Spectrometry:

    • Apply membrane-permeable cross-linkers to intact cells or membrane preparations

    • Identify cross-linked peptides by mass spectrometry

    • Map interaction interfaces at amino acid resolution

  • Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI):

    • Immobilize purified ydcV on sensor chips or biosensors

    • Measure binding kinetics with potential interaction partners

    • Determine affinity constants for interactions

  • Native Mass Spectrometry:

    • Analyze intact membrane protein complexes

    • Determine stoichiometry and composition of complexes

    • Study dynamics of complex assembly and disassembly

  • Co-evolution Analysis:

    • Implement computational methods to identify co-evolving residues

    • Predict interaction interfaces based on evolutionary coupling

    • Validate predictions with targeted mutagenesis

When designing these experiments, researchers should carefully control for non-specific interactions common in membrane protein studies and validate key findings using multiple complementary approaches.

How does ydcV transport mechanism relate to the broader energetics and allosteric regulation of ABC transporters?

The transport mechanism of ydcV likely follows the general principles of ABC transporters but may have specific adaptations related to its substrate specificity and physiological role. Understanding its broader energetics and regulation requires sophisticated experimental approaches:

  • Conformational Dynamics Investigation:

    • Implement single-molecule FRET to monitor conformational changes during transport

    • Study the effect of ATP binding, hydrolysis, and release on conformational states

    • Investigate how substrate binding affects nucleotide hydrolysis rates

    • Examine the allosteric communication between the transmembrane domains (including ydcV) and the nucleotide-binding domains

  • Energetic Coupling Analysis:

    • Investigate the coupling efficiency between ATP hydrolysis and substrate transport

    • Measure the stoichiometry of ATP molecules hydrolyzed per substrate molecule transported

    • Study how membrane potential and other energetic parameters affect transport efficiency

    • Examine possible uncoupling mechanisms under stress conditions

  • Structural Transitions Research:

    • Based on the alternating access model, identify key residues involved in the transition between inward-facing and outward-facing conformations

    • Study the role of conserved motifs in transmembrane helices

    • Investigate potential intermediate conformational states during transport

  • Regulatory Integration:

    • Examine how ydcV activity might be regulated by cellular signaling pathways

    • Study potential post-translational modifications affecting transport activity

    • Investigate how substrate availability influences transporter expression and activity

    • Research the integration of ydcV function with broader cellular metabolic networks

This research should consider the emerging understanding of ABC transporters as potentially serving regulatory roles beyond simple transport, possibly functioning as sensors or signaling hubs in cellular processes .

What approaches can be used to study the potential role of ydcV in antibiotic resistance and development of inhibitors?

Given that some ABC transporters contribute to antibiotic resistance, studying ydcV's potential role in this context requires specialized approaches:

  • Resistance Profiling:

    • Compare minimum inhibitory concentrations (MICs) of various antibiotics between wild-type and ydcV knockout strains

    • Perform time-kill assays to assess dynamics of antibiotic action

    • Measure antibiotic accumulation in cells with altered ydcV expression

    • Create overexpression systems to assess if increased ydcV confers resistance

  • Transport Assays with Antimicrobials:

    • Develop fluorescence-based assays for antibiotic transport

    • Implement radioactively labeled antibiotic accumulation studies

    • Assess competition between antibiotics and natural substrates

    • Study kinetics of antibiotic transport or efflux

  • Inhibitor Development Strategy:

    • Perform high-throughput screening of chemical libraries for ydcV inhibitors

    • Implement structure-based drug design if structural data is available

    • Develop competitive inhibitors based on natural substrates

    • Design inhibitors targeting the interface between ydcV and its associated nucleotide-binding domain

  • Synergy Testing:

    • Evaluate potential synergy between ydcV inhibitors and existing antibiotics

    • Use checkerboard assays to quantify fractional inhibitory concentration indices

    • Implement time-kill assays to assess dynamic interactions

    • Develop mathematical models of synergistic interactions

  • Resistance Mechanism Elucidation:

    • Study the molecular basis for substrate recognition

    • Identify key residues involved in antibiotic binding through site-directed mutagenesis

    • Investigate structural changes associated with polyspecificity in antibiotic recognition

    • Examine how ydcV might contribute to intrinsic versus acquired resistance

  • Clinical Relevance Assessment:

    • Analyze clinical isolates for ydcV expression levels

    • Correlate ydcV polymorphisms with resistance phenotypes

    • Study ydcV regulation in response to antibiotic exposure in clinical settings

    • Implement pharmacokinetic/pharmacodynamic (PK/PD) modeling to predict efficacy of ydcV inhibition strategies

This research has translational potential for developing adjuvants that could potentiate existing antibiotics by inhibiting efflux mechanisms.

How can researchers address challenges in data interpretation when studying ydcV function in complex cellular systems?

Researching ydcV function in complex cellular systems presents several interpretive challenges that require careful experimental design and analytical approaches:

By systematically addressing these challenges, researchers can develop more robust interpretations of experimental data and build more accurate models of ydcV function in its native cellular context.

What are the most promising future research directions for understanding ydcV function in bacterial physiology?

Several promising research directions could significantly advance our understanding of ydcV function:

  • Systems-Level Integration:

    • Map the complete interactome of ydcV to understand its place in cellular networks

    • Investigate how ydcV function changes across different growth phases and stress conditions

    • Develop computational models that predict cellular responses to ydcV perturbation

    • Study ydcV regulation in the context of global bacterial stress responses

  • Evolutionary Perspectives:

    • Conduct comparative genomics across bacterial species to trace ydcV evolution

    • Identify conserved versus variable regions that might indicate functional specialization

    • Investigate horizontal gene transfer events involving ydcV and related transporters

    • Reconstruct the evolutionary history of substrate specificity

  • Single-Cell Technologies:

    • Apply microfluidics and time-lapse microscopy to study ydcV function in individual cells

    • Investigate cell-to-cell variability in transport activity

    • Examine how ydcV contributes to phenotypic heterogeneity in bacterial populations

    • Develop single-cell transport assays with fluorescent substrates

  • Structural Dynamics:

    • Characterize the complete transport cycle using time-resolved structural methods

    • Study conformational ensembles rather than static structures

    • Investigate how lipid composition affects structural transitions

    • Develop methods to trap and characterize transient conformational states

  • Biotechnological Applications:

    • Explore potential applications in biosensor development

    • Engineer ydcV for altered substrate specificity

    • Investigate applications in metabolic engineering for bioproduction

    • Develop ydcV-based screening systems for drug discovery

  • Integration with Host-Pathogen Interactions:

    • Study how ydcV function might contribute to bacterial virulence

    • Investigate potential roles in host colonization or immune evasion

    • Examine ydcV regulation during infection processes

    • Consider ydcV as a potential target for anti-virulence strategies

These research directions would benefit from the development of new methodologies, particularly those that allow real-time monitoring of transport activity in living cells and methods for correlating structural dynamics with functional states.

How can researchers effectively integrate computational and experimental approaches in studying ydcV?

Effective integration of computational and experimental approaches can accelerate understanding of ydcV through an iterative research cycle:

  • Structure Prediction and Refinement:

    • Use AI-based structure prediction tools (e.g., AlphaFold) as starting points

    • Refine predictions with molecular dynamics simulations in membrane environments

    • Validate computational models with limited experimental constraints (crosslinking, EPR)

    • Identify functionally important residues for experimental testing

  • Molecular Dynamics Simulations:

    • Simulate ydcV in lipid bilayers to understand conformational dynamics

    • Model substrate binding and transport pathways

    • Predict effects of mutations on structure and function

    • Investigate allosteric communication between domains

  • Systems Biology Modeling:

    • Develop kinetic models of transport incorporating experimental rate constants

    • Create genome-scale metabolic models including ydcV function

    • Simulate effects of environmental changes on transporter activity

    • Predict phenotypic consequences of ydcV perturbation

  • Machine Learning Applications:

    • Predict substrate specificity from sequence and structural features

    • Identify patterns in regulation across multiple conditions

    • Develop models for virtual screening of potential inhibitors

    • Extract meaningful patterns from complex multi-omics datasets

  • Integrated Research Workflow:

    • Begin with computational predictions of structure and function

    • Design targeted experiments to test specific hypotheses

    • Use experimental data to refine computational models

    • Implement a cycle of prediction, testing, refinement, and validation

  • Data Management and Integration:

    • Establish databases to integrate diverse experimental results

    • Develop visualization tools for complex datasets

    • Implement reproducible computational workflows

    • Apply meta-analysis approaches to identify consistent patterns across studies

The most successful integration approaches maintain continuous dialogue between computational and experimental scientists, with each approach informing and constraining the other to drive research forward more efficiently than either could alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.