Recombinant Inner membrane amino-acid ABC transporter permease protein yecS (yecS)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Inner Membrane Amino-Acid ABC Transporter Permease Protein yecS (yecS)

The recombinant inner membrane amino-acid ABC transporter permease protein yecS (Uniprot: P0AFT3) is a membrane-embedded component of the ABC transporter complex FliY-YecC-YecS in Escherichia coli. This system facilitates the transport of L-cystine, L-cysteine, and related sulfur-containing compounds across bacterial membranes . As part of the ATP-binding cassette (ABC) transporter superfamily, yecS functions as a permease subunit, translocating substrates in coordination with ATP hydrolysis by its ATPase partner, YecC .

Functional Role in ABC Transporter Complexes

yecS operates as part of the FliY-YecC-YecS transporter, which:

  • Transports L-cystine and L-cysteine: Binds substrates via the periplasmic substrate-binding protein (SBP) FliY .

  • Accumulates Toxic Analogues: Mediates uptake of selenoproline (SCA) and selenocystine (SeCys), which are toxic to E. coli .

  • Exhibits Enantiomer Selectivity: Preferentially binds L-cysteine over D-cysteine, modulating ATPase activity of YecC .

Key Interactions (from STRING database analysis):

Partner ProteinRoleInteraction Score
yecCATPase subunit (energy coupling)0.999
fliYSBP (substrate recognition)0.999
gltLGlutamate/aspartate transporter ATPase0.992
artJArginine-binding SBP0.989

The yecS-YecC complex interacts with FliY, which delivers substrate-bound conformations that stimulate ATP hydrolysis .

Mechanistic Insights from Biochemical Studies

Research on the YecSC-FliY system reveals distinct mechanistic features:

ATPase Activity Modulation

  • Basal ATP Hydrolysis: Low activity in the absence of FliY .

  • FliY-Dependent Stimulation:

    • Apo-FliY: Moderate stimulation (~2× basal rate).

    • D-Cysteine-FliY: Stronger stimulation (~4× basal rate).

    • L-Cysteine/L-Cystine-FliY: Maximal stimulation (~8× basal rate) .

Conformational Dynamics

FliY exists in equilibrium between open (inactive) and closed (active) states. Substrate binding induces distinct conformations:

  • L-Enantiomers: Promote tighter binding to YecSC, enhancing ATPase activity.

  • D-Enantiomers: Bind FliY but fail to stabilize the transporter-SBP interaction .

Applications and Research Implications

While not directly therapeutic, recombinant yecS serves as a model for studying:

  1. ABC Transporter Mechanisms: Discrimination between substrate enantiomers and coupling of ATP hydrolysis to transport .

  2. Toxin Uptake: Insights into bacterial susceptibility to selenoamino acids .

  3. Biotechnological Engineering: Potential for designing synthetic transport systems for sulfur-containing metabolites.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tcyL; yecS; SF1961; S2057; L-cystine transport system permease protein TcyL
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-222
Protein Length
full length protein
Species
Shigella flexneri
Target Names
yecS
Target Protein Sequence
MQESIQLVIDSLPFLLKGAGYTLQLSIGGMFFGLLLGFILALMRLSPIWPVRWLARFYIS IFRGTPLIAQLFMIYYGLPQFGIELDPIPSAMIGLSLNTAAYAAETLRAAISSIDKGQWE AAASIGMTPWQTMRRAILPQAARVALPPLSNSFISLVKDTSLAATIQVPELFRQAQLITS RTLEVFTMYLAASLIYWIMATVLSTLQNHFENQLNRQEREPK
Uniprot No.

Target Background

Function
A component of the ABC transporter complex TcyJLN, involved in L-cystine uptake. It facilitates substrate translocation across the cell membrane.
Database Links

KEGG: sfl:SF1961

Protein Families
Binding-protein-dependent transport system permease family, HisMQ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is yecS protein and what is its fundamental function?

The yecS protein (P0AFT2) is an inner membrane amino-acid ABC transporter permease protein encoded by the yecS gene (b1918) in Escherichia coli. It functions as a critical component of the binding-protein-dependent transport system for amino acids, specifically the yecCS system. The protein is primarily responsible for the translocation of amino acid substrates across the inner bacterial membrane .

yecS is classified as a multi-pass membrane protein located in the cell inner membrane, with 222 amino acid residues and a molecular weight of 24,801 Da. With a theoretical isoelectric point (pI) of 10, it exhibits a notably basic character. The protein's gene is oriented counterclockwise on the E. coli chromosome at approximately 43.02 centisomes, spanning nucleotide positions 1,995,835 to 1,996,503 .

The functional significance of yecS lies in its role as part of the ABC transporter complex that facilitates the active transport of specific amino acids against concentration gradients, which is essential for bacterial metabolism and survival. ABC transporters like yecS utilize ATP hydrolysis to power this transport, making them crucial components in bacterial nutrient acquisition systems.

How does yecS relate to the broader family of ABC transporters?

yecS belongs to the extensive superfamily of ATP-binding cassette (ABC) transporters, which are ubiquitous across all domains of life. In bacterial systems, ABC transporters typically consist of three components: a substrate-binding protein (SBP), a transmembrane domain (TMD), and a nucleotide-binding domain (NBD). yecS functions as part of the transmembrane domain, forming the channel through which substrates pass.

The yecS protein works in concert with other components of the ABC transporter complex. Based on its classification, yecS likely functions alongside an ATP-binding protein that provides energy through ATP hydrolysis and a substrate-binding protein that initially captures the amino acid substrate from the periplasmic space. Together, these components form a complete transport system that enables selective and active transport of amino acids into the bacterial cell .

Understanding the relationship between yecS and other ABC transporters provides valuable insights into bacterial physiology and potential targets for antimicrobial development, since these transport systems are essential for bacterial survival and virulence.

What expression systems are most effective for recombinant yecS production?

For expression of yecS, several systems can be considered:

  • E. coli Expression System:

    • Advantages: Rapid growth, inexpensive cultivation, well-established protocols, and a wealth of available expression vectors .

    • Challenges: Membrane proteins often form inclusion bodies or exhibit toxicity to the host when overexpressed.

    • Methodology: Using specialized E. coli strains (C41, C43, or Lemo21) and vectors with tunable promoters (such as pET vectors with T7lac promoters) can improve success rates.

  • Yeast Expression Systems:

    • Advantages: As eukaryotic hosts, yeast systems like Pichia pastoris provide better membrane protein folding machinery and can achieve higher specific yields for challenging proteins .

    • Methodology: Gene optimization for yeast codon usage and selection of appropriate signal sequences for membrane targeting are essential for successful expression.

  • Cell-Free Expression Systems:

    • Advantages: Avoids cell viability issues related to membrane protein toxicity.

    • Methodology: Supplementation with lipids or detergents creates an environment conducive to proper membrane protein folding.

The choice between these systems depends on the specific research goals. E. coli remains valuable for initial screening and structure-function studies, while yeast systems may prove superior for obtaining larger quantities of properly folded protein.

What are the primary challenges in purifying recombinant yecS and how can they be addressed?

Purification of recombinant yecS presents several challenges inherent to membrane proteins. These challenges and their potential solutions include:

  • Extraction from the Membrane:

    • Challenge: Membrane proteins exist in a lipid environment, making their extraction while maintaining native structure difficult.

    • Solution: Careful selection of detergents is crucial. Starting with milder detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) often preserves protein integrity better than harsher options like Triton X-100.

  • Maintaining Stability:

    • Challenge: Once extracted from the membrane, yecS may exhibit reduced stability in detergent micelles.

    • Solution: Addition of specific lipids (like E. coli polar lipids) to purification buffers can enhance stability. Using styrene-maleic acid copolymer (SMA) to extract the protein with its native lipid environment is an emerging alternative.

  • Purification Strategy:

    • Challenge: Achieving high purity without compromising function.

    • Solution: A multi-step approach typically works best:

      • Initial capture using immobilized metal affinity chromatography (IMAC) via an engineered His-tag

      • Secondary purification using size exclusion chromatography (SEC)

      • Optional ion exchange chromatography for further purification

  • Protein Yield Assessment:

    • Challenge: Quantifying membrane proteins in detergent solutions.

    • Solution: A combination of methods including BCA assay (with detergent-compatible reagents), SDS-PAGE with standard curves, and intrinsic fluorescence measurements.

How can researchers assess the functional integrity of purified yecS?

Verifying that purified yecS retains its native structural and functional properties is essential before proceeding with advanced studies. Several complementary approaches can be employed:

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to verify secondary structure elements

    • Thermal stability assays using differential scanning fluorimetry (DSF) or nanoDSF

    • Limited proteolysis to assess proper folding based on protease accessibility patterns

  • Functional Assays:

    • Reconstitution into proteoliposomes to measure substrate transport

    • ATPase activity assays with reconstituted ABC transporter complex

    • Substrate binding assays using fluorescently labeled amino acids

  • Interaction Studies:

    • Co-purification with known interaction partners

    • Surface plasmon resonance (SPR) to measure binding to substrate-binding proteins

    • Native mass spectrometry to assess complex formation

A comprehensive validation approach would typically include at least one method from each category to ensure that the purified protein maintains both structural and functional integrity.

What methodologies are available for determining the structure of yecS?

Determining the structure of membrane proteins like yecS presents unique challenges compared to soluble proteins. Several complementary approaches can be employed:

  • X-ray Crystallography:

    • Methodology: Involves solubilizing yecS in detergents, followed by crystallization trials in various conditions. Membrane protein crystallization often benefits from specialized approaches like lipidic cubic phase (LCP) crystallization.

    • Challenges: Membrane proteins like yecS are notoriously difficult to crystallize due to their hydrophobic surfaces and flexibility.

    • Solutions: Systematic screening with different detergents, stabilizing mutations, antibody fragments (Fab or nanobody) co-crystallization, and fusion with crystallization chaperones like T4 lysozyme.

  • Cryo-Electron Microscopy (Cryo-EM):

    • Methodology: Vitrification of yecS in detergent micelles, nanodiscs, or amphipols followed by single-particle analysis.

    • Advantages: Does not require crystallization and can capture multiple conformational states.

    • Considerations: Smaller proteins like yecS (24.8 kDa) are challenging for cryo-EM, though advances in technology have pushed the size limits downward.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Methodology: Requires isotopic labeling (15N, 13C) of recombinant yecS, followed by solubilization in detergent micelles or reconstitution into nanodiscs.

    • Applications: Particularly valuable for studying dynamics and ligand interactions.

    • Limitations: Size constraints may necessitate studying individual domains rather than the full protein.

  • Integrative Structural Biology:

    • Methodology: Combines low-resolution techniques (SAXS, cross-linking mass spectrometry) with computational modeling.

    • Advantage: Can provide structural insights when high-resolution methods fail.

The choice of method depends on research goals, available resources, and the specific properties of yecS. Often, a combination of approaches yields the most comprehensive structural understanding.

How can researchers investigate the substrate binding and transport mechanism of yecS?

Understanding how yecS recognizes and transports its amino acid substrates requires specialized approaches that probe both binding events and the subsequent conformational changes:

  • Substrate Binding Analysis:

    • Isothermal Titration Calorimetry (ITC): Measures thermodynamic parameters of substrate binding

    • Microscale Thermophoresis (MST): Detects binding-induced changes in thermophoretic mobility

    • Fluorescence-based assays using environmentally sensitive probes

    • Surface Plasmon Resonance (SPR) for real-time binding kinetics

  • Transport Activity Measurement:

    • Proteoliposome-based transport assays using radiolabeled or fluorescently labeled substrates

    • Electrophysiological measurements in reconstituted systems

    • Real-time fluorescence-based transport assays using pH-sensitive or substrate-sensitive fluorophores

  • Conformational Change Analysis:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map regions undergoing conformational changes

    • Double electron-electron resonance (DEER) spectroscopy using site-specifically labeled cysteine residues

    • Single-molecule FRET to track distance changes between labeled domains during transport

    • Time-resolved crystallography or cryo-EM to capture transport intermediates

  • In silico Approaches:

    • Molecular docking to predict substrate binding modes

    • Molecular dynamics simulations to model conformational changes during transport

    • Machine learning approaches to predict substrate specificity

A comprehensive understanding of yecS function typically emerges from integrating multiple methods, correlating structural information with functional data to develop mechanistic models of substrate recognition and transport.

How can site-directed mutagenesis be used to investigate yecS function?

Site-directed mutagenesis represents a powerful approach for dissecting the functional mechanisms of yecS at the molecular level. By strategically introducing specific amino acid changes, researchers can systematically probe the roles of individual residues in substrate recognition, transport, and protein stability.

A methodological framework for mutagenesis studies of yecS includes:

  • Rational Design of Mutations:

    • Conservation analysis: Identifying highly conserved residues across bacterial permease proteins

    • Structure-based targeting: Using homology models or experimental structures to identify residues lining the putative transport pathway

    • Charge swap experiments: Mutating charged residues (Arg, Lys, Asp, Glu) to opposite charges to test electrostatic interactions

    • Substrate-interacting residues: Systematic alanine scanning of residues predicted to interact with amino acid substrates

  • Mutant Production Protocol:

    • QuikChange or Q5 site-directed mutagenesis on expression plasmids

    • Gibson Assembly for introducing multiple mutations simultaneously

    • Expression screening in small-scale cultures to assess protein stability

    • Purification using identical protocols to wild-type protein for fair comparison

  • Functional Characterization:

    • Transport assays comparing wild-type and mutant activity

    • Binding affinity measurements to distinguish between binding and transport defects

    • Thermostability analysis to assess structural impact

    • ATPase activity measurements to test coupling between permease and nucleotide-binding domains

  • Data Analysis and Interpretation:

    • Correlation of mutational effects with structural features

    • Classification of mutations into functional categories (binding, transport, stability, etc.)

    • Development of refined mechanistic models based on mutational data

Mutation TypePurposeExample Targets in yecSExpected Outcome
Alanine SubstitutionRemoves side chain interactionsConserved polar/charged residuesIdentifies essential residues
Conservative SubstitutionsMaintains chemical propertiesLeu→Ile, Asp→GluTests importance of side chain size/length
Non-conservative SubstitutionsChanges chemical propertiesArg→Glu, Ser→AlaTests importance of specific interactions
Cysteine SubstitutionsEnables chemical labelingSurface-exposed positionsCreates sites for fluorescent labeling

By systematically analyzing the effects of these mutations on protein function, researchers can develop detailed models of how yecS recognizes and transports its substrates across the membrane.

What approaches can be used to study yecS interactions with other components of the ABC transporter complex?

Understanding how yecS interacts with other components of its ABC transporter complex is crucial for elucidating the complete transport mechanism. Several complementary approaches can reveal these interactions:

  • Co-purification and Pull-down Assays:

    • Methodology: Expression of yecS with affinity-tagged partner proteins, followed by tandem affinity purification

    • Analysis: SDS-PAGE, Western blotting, and mass spectrometry to identify and quantify interacting partners

    • Advantage: Can identify stable, high-affinity interactions

    • Limitation: May miss transient or condition-specific interactions

  • In vivo Crosslinking:

    • Methodology: Chemical crosslinking of whole cells expressing yecS, followed by affinity purification and mass spectrometry

    • Applications: Captures physiologically relevant interactions in their native membrane environment

    • Variants: Photo-crosslinking using genetically incorporated unnatural amino acids can provide site-specific crosslinking

  • Förster Resonance Energy Transfer (FRET):

    • Methodology: Fluorescent labeling of yecS and potential partner proteins, followed by FRET measurements

    • Applications: Real-time monitoring of protein interactions in reconstituted systems or live cells

    • Advantage: Can detect dynamic changes in protein association during the transport cycle

  • Genetic Approaches:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Genetic suppressor analysis to identify compensatory mutations

    • Synthetic lethality screening to identify functional relationships

  • Structural Studies of Complexes:

    • Cryo-EM of the assembled transporter complex

    • Crosslinking mass spectrometry (XL-MS) to map interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify protected regions

These approaches collectively provide a comprehensive understanding of how yecS integrates into the functional ABC transporter complex, revealing both the structural architecture and the dynamic associations that drive the transport cycle.

How can researchers exploit yecS as a model system for understanding membrane protein folding?

The yecS protein represents an excellent model system for investigating fundamental questions about membrane protein folding and stability. Its moderate size, essential function, and bacterial origin make it particularly suitable for such studies. Several methodological approaches can leverage yecS for membrane protein folding research:

  • In vitro Folding Studies:

    • Methodology: Denaturation of purified yecS followed by systematic refolding in different lipid/detergent environments

    • Measurements: Circular dichroism (CD) spectroscopy to track secondary structure formation

    • Variables to test: Lipid composition, pH, ionic strength, temperature, and presence of chaperones

    • Analysis: Folding kinetics and efficiency under different conditions

  • Co-translational Folding Analysis:

    • Methodology: Ribosome nascent chain complexes (RNCs) with arrested translation of yecS at different lengths

    • Techniques: Cryo-EM, crosslinking, and accessibility assays to monitor interaction with insertion machinery

    • Questions addressed: How does the translocon recognize and insert transmembrane segments? What is the timing of helix insertion?

  • Force Microscopy Approaches:

    • Methodology: Single-molecule force spectroscopy to measure unfolding and refolding forces

    • Applications: Determining the mechanical stability of individual transmembrane helices

    • Insights: Energy landscape of membrane protein folding

  • Minimal Folding Units:

    • Methodology: Expression and characterization of individual transmembrane segments or paired helices

    • Analysis: Determining which segments can fold independently versus those requiring the context of the full protein

    • Applications: Design of simplified membrane protein models

  • Computational Approaches:

    • Molecular dynamics simulations of yecS folding intermediates

    • Prediction of folding pathways and critical interactions

    • Integration with experimental data to refine computational models

Folding ParameterMeasurement TechniqueInformation Obtained
Thermodynamic StabilityDifferential scanning calorimetryFree energy of folding
Kinetic StabilityPulse-chase assaysHalf-life of folded state
Folding IntermediatesHDX-MS with quench flowSequential structural formation
Misfolding PropensityAggregation assaysConditions promoting misfolding
Chaperone DependenciesCo-expression studiesRequired folding assistance

Through these approaches, yecS can serve as a tractable model system to elucidate the fundamental principles governing membrane protein folding, with implications for understanding protein misfolding diseases and improving recombinant membrane protein production.

How does yecS compare with homologous proteins in other bacterial species?

Comparative analysis of yecS across bacterial species provides valuable insights into evolutionary conservation, functional specialization, and structural determinants of substrate specificity. This comparative approach involves several methodological components:

  • Sequence-Based Analysis:

    • Multiple sequence alignment of yecS homologs from diverse bacterial phyla

    • Calculation of conservation scores for each amino acid position

    • Identification of species-specific variations in key functional regions

    • Phylogenetic tree construction to map evolutionary relationships

  • Structure-Function Relationship Mapping:

    • Mapping of conserved residues onto structural models or experimental structures

    • Identification of conserved structural motifs versus variable regions

    • Correlation of sequence diversity with substrate specificity differences

  • Comparative Functional Studies:

    • Heterologous expression of yecS homologs from different bacterial species

    • Comparative transport assays to determine substrate range differences

    • Creation of chimeric proteins exchanging regions between homologs to pinpoint specificity determinants

  • Genomic Context Analysis:

    • Examination of operonic organization across species

    • Identification of co-evolved components (ATP-binding proteins, substrate-binding proteins)

    • Correlation of genomic context with metabolic capabilities of different bacteria

This comprehensive comparative approach not only illuminates the evolutionary history of yecS but also provides practical insights for protein engineering efforts aimed at modifying substrate specificity or improving stability.

What approaches can be used to study the integration of yecS function with bacterial physiology?

Understanding how yecS activity integrates with broader bacterial physiology requires systems-level approaches that connect molecular function to cellular outcomes:

  • Gene Deletion and Complementation Studies:

    • Construction of yecS knockout strains using CRISPR-Cas9 or traditional homologous recombination

    • Phenotypic characterization under various nutritional conditions

    • Complementation with wild-type and mutant variants to establish structure-function relationships in vivo

    • Competitive growth assays to quantify subtle fitness effects

  • Metabolomics Approaches:

    • Comparative metabolite profiling of wild-type versus yecS-deficient strains

    • Isotope labeling to track amino acid uptake and metabolic fates

    • Identification of metabolic bottlenecks resulting from transport deficiencies

  • Transcriptomics and Proteomics:

    • RNA-seq analysis to identify compensatory responses to yecS deletion

    • Quantitative proteomics to measure changes in protein abundance

    • Phosphoproteomics to detect signaling responses to altered amino acid availability

  • Integration with Stress Responses:

    • Examination of yecS regulation under various stress conditions

    • Assessment of yecS contribution to stress tolerance

    • Connection between transport activity and bacterial adaptation

These approaches collectively reveal how yecS function contributes to bacterial fitness in different environments and how its activity is coordinated with broader cellular processes. Such insights not only advance basic understanding of bacterial physiology but may also identify potential intervention points for antimicrobial development.

What are the best fluorescent labeling strategies for tracking yecS localization and dynamics?

Fluorescent labeling of yecS enables visualization of its subcellular localization, trafficking, and dynamic behavior. Several approaches are suitable for different experimental goals:

  • Genetic Fusion Approaches:

    • Methodology: C- or N-terminal fusion of fluorescent proteins (FPs) to yecS

    • Considerations: Terminal fusions may interfere with function; internal fusions into permissive loops may preserve activity

    • Validation: Functional assays to ensure labeled protein retains transport activity

    • Applications: Long-term visualization in living cells, pulse-chase experiments with photoconvertible FPs

  • Site-Specific Labeling Strategies:

    • Unnatural amino acid incorporation: Amber suppression to introduce click-chemistry handles

    • SNAP/CLIP/Halo-tag fusions: Enzymatic labeling with synthetic fluorophores

    • Split-GFP complementation: For studying protein-protein interactions

    • Applications: Super-resolution microscopy requiring small, bright fluorophores

  • Experimental Considerations:

    • Verification of functional integrity post-labeling

    • Optimization of expression levels to avoid artifacts

    • Controls for potential mislocalization due to overexpression

    • Selection of appropriate fluorophores based on experimental requirements

  • Advanced Imaging Applications:

    • Single-particle tracking to measure diffusion rates in the membrane

    • Fluorescence recovery after photobleaching (FRAP) to measure mobility

    • Single-molecule localization microscopy for nanoscale distribution analysis

    • Fluorescence correlation spectroscopy (FCS) for concentration and oligomerization state

These fluorescent labeling approaches provide powerful tools for visualizing yecS behavior in its native cellular context, connecting molecular function to cellular organization and dynamics.

How can researchers develop high-throughput screening assays for yecS function?

Developing high-throughput assays for yecS function enables screening of mutant libraries, potential inhibitors, or environmental conditions affecting transport activity. Several methodological approaches can be adapted to high-throughput formats:

  • Cell-Based Transport Assays:

    • Methodology: Expression of yecS in transport-deficient bacterial strains, followed by measurement of substrate uptake

    • Readout options: Growth-based selection, fluorescent substrate accumulation, or reporter gene activation

    • Adaptation to high-throughput: 96/384-well plate format with automated liquid handling

    • Applications: Mutant library screening, inhibitor discovery

  • In vitro Reconstituted Systems:

    • Methodology: Reconstitution of purified yecS into liposomes or nanodiscs with encapsulated indicators

    • Readout options: Fluorescent or colorimetric detection of transport activity

    • High-throughput implementation: Multiwell plate assays with reconstituted proteoliposomes

    • Advantages: Direct measurement of transport without cellular background

  • Binding Assays:

    • Methodology: Detection of substrate binding to purified yecS

    • Techniques: Fluorescence polarization, thermal shift assays, surface plasmon resonance

    • High-throughput adaptation: Automated liquid handling and plate-based detection

    • Applications: Fragment screening for binding site mapping

  • Stability and Expression Screens:

    • Methodology: Assessment of expression levels and stability of yecS variants

    • Techniques: GFP-fusion reporters, split-GFP complementation, or thermostability assays

    • Applications: Identifying stabilizing mutations or conditions for structural studies

The selection of an appropriate high-throughput approach depends on the specific research questions being addressed and the available resources. These methods collectively enable rapid screening of large parameter spaces, accelerating discovery in yecS research.

What are the emerging technologies that could advance yecS research?

Several cutting-edge technologies show promise for transforming our understanding of yecS structure, function, and cellular role:

  • Cryo-Electron Tomography:

    • Applications: Visualizing yecS in its native membrane environment at molecular resolution

    • Advantages: Captures natural distribution, associations, and conformational states

    • Future developments: Improved resolution and in situ labeling approaches

  • Advanced Mass Spectrometry:

    • Native MS for intact membrane protein complexes

    • Ion mobility-MS for structural characterization

    • Mass photometry for oligomerization state determination

    • Single-cell proteomics for cell-to-cell variation in expression

  • Artificial Intelligence and Machine Learning:

    • Improved protein structure prediction specifically for membrane proteins

    • Automated image analysis for high-content screening data

    • Prediction of transport properties based on sequence features

    • Design of optimized variants with enhanced stability or function

  • Genome Editing Technologies:

    • CRISPR interference for tunable gene expression control

    • Base editing for precise introduction of point mutations

    • Prime editing for complex genomic modifications

    • Applications: Creating libraries of genomic variants for functional studies

  • Advanced Reconstitution Systems:

    • Cell-free expression directly into synthetic membranes

    • Microfluidic systems for single-transporter studies

    • Biomimetic membrane systems with controlled composition

    • Advantages: Precise control over experimental conditions

These emerging technologies promise to overcome current limitations in yecS research, enabling more detailed structural insights, more sensitive functional assays, and better integration of molecular mechanisms with cellular physiology.

What are the most promising translational applications of yecS research?

While fundamental understanding of yecS biology is valuable in its own right, several translational applications show particular promise:

  • Antimicrobial Development:

    • Rationale: Transport systems like yecS are essential for bacterial survival

    • Approach: Structure-based design of specific inhibitors

    • Advantages: Novel targets may overcome existing resistance mechanisms

    • Challenges: Achieving selectivity for bacterial transporters

  • Biotechnological Applications:

    • Engineering yecS for improved uptake of non-natural amino acids

    • Development of biosensors based on yecS transport properties

    • Creation of bacterial strains with enhanced amino acid utilization for industrial fermentation

    • Applications in metabolic engineering and synthetic biology

  • Model System for Membrane Protein Production:

    • Optimization of expression and purification protocols

    • Development of general stabilization strategies

    • Establishment of predictive tools for membrane protein behavior

    • Broader impact on structural biology of challenging membrane proteins

  • Understanding Transport-Related Diseases:

    • Insights into human ABC transporter mechanisms

    • Relevance to disorders like cystic fibrosis involving defective ABC transporters

    • Potential for developing therapeutic strategies based on mechanistic understanding

These translational directions highlight the broader impact of fundamental research on yecS, connecting basic science to applications in medicine, biotechnology, and protein science.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.