Recombinant Inner membrane protein CbrB (cbrB)

Shipped with Ice Packs
In Stock

Description

Primary Structure

  • Amino Acid Sequence: Variants differ slightly across E. coli strains. For example:

    • E. coli K12: MSVSRRVIHHGLYFAVLGPLIGVLFLVLYIFFAKEPLVLWVIIHPIFLLLSITTGAIPALLTGVMVACLPEK...

    • E. coli O6: MSVSRRVIHHGLYFAVLGPLIGVLFLVLYIFFAKEPLILLVIIQVLPLFILLSITTGAIPAMLTGVMVACLPEK...

  • Length: Typically spans 155–157 amino acids, depending on the strain and construct .

Domain Architecture

  • Predicted transmembrane (TM) helices: Structural modeling suggests multiple α-helical segments embedded in the membrane .

  • Tagging: Often includes an N-terminal 10xHis tag for purification .

Production and Expression Systems

Recombinant CbrB is synthesized using advanced expression platforms optimized for membrane proteins:

ParameterDetailsSource
Expression HostEscherichia coli (strains K12, O1, O6)
Expression KitMembraneMax™ or baculovirus systems for improved solubility and folding
PurificationAffinity chromatography (His-tag), >85% purity confirmed by SDS-PAGE
Storage-20°C to -80°C in Tris-based buffer with 50% glycerol; avoid freeze-thaw cycles

Putative Roles

  • Membrane Biogenesis: Likely participates in maintaining membrane structure, analogous to other inner membrane proteins .

  • Regulatory Interactions: In Pseudomonas putida, the CbrAB two-component system (not directly related to E. coli CbrB) regulates carbon metabolism via histidine kinase signaling .

Experimental Observations

  • Stability: Retains activity for 6–12 months under recommended storage conditions .

  • Applications: Used in structural studies (e.g., crystallography) and membrane protein interaction assays .

Research Challenges and Future Directions

  • Functional Characterization: Limited data on enzymatic or signaling roles necessitate further studies, such as knock-out assays or interactome profiling .

  • Structural Resolution: No published 3D structures exist; cryo-EM or X-ray crystallography could elucidate its topology .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
cbrB; c4639; Inner membrane protein CbrB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Target Names
cbrB
Target Protein Sequence
MSVSRRVIHHGLYFAVLGPLIGVLFLVLYIFFAKEPLILLVIIQVLPLFILLSITTGAIP AMLTGVMVACLPEKIGSQKRYRCLVGGIGGVVITEIYCAVIVHIKDMASSALFENILSGE NLVVRIIPALLAGVVMSRIITHLPGLDISCPETDSLS
Uniprot No.

Target Background

Database Links

KEGG: ecc:c4639

STRING: 199310.c4639

Protein Families
CbrB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is CbrB and what is its function in bacterial systems?

CbrB is a response regulator protein in the CbrA/CbrB two-component system found in Pseudomonas species including P. aeruginosa, P. fluorescens, and P. putida. It functions as a transcriptional activator for σ54 RNA polymerase and belongs to the NtrC family of response regulators . The CbrA/CbrB system is instrumental in maintaining carbon-nitrogen balance and enabling growth on carbon sources that are energetically less favorable than preferred dicarboxylate substrates . CbrB drives the expression of the small RNA CrcZ, which antagonizes the repressing effects of the catabolite repression control protein Crc . Mutations in cbrA and cbrB prevent growth on numerous carbon and nitrogen sources, disrupt carbon-nitrogen balance, and affect biofilm development and stress tolerance .

What is the molecular mechanism of CbrB activation?

CbrB is activated through phosphorylation by its cognate sensor kinase CbrA. The activated CbrB recognizes a conserved palindromic nucleotide sequence present in the upstream activating sequences (UASs) of promoters under its control, particularly in the UAS of the crcZ promoter . This recognition and binding enable CbrB to activate transcription of target genes. Integration host factor (IHF) has been shown to be required for crcZ expression, suggesting a complex regulatory mechanism . The signals that interact with the membrane-bound CbrA sensor remain unknown, though TCA cycle intermediates appear to have an inhibitory effect on CbrA/CbrB activity .

How does CbrB compare to other bacterial response regulators?

CbrB shares functional and structural similarities with other response regulators of the NtrC family. The CbrB recognition sequence has significant similarity to the consensus NtrC recognition sequence used in nitrogen control systems . This similarity suggests evolutionary relationships and possibly overlapping regulatory networks between carbon and nitrogen regulation systems in bacteria. Like other NtrC-type regulators, CbrB works with σ54 RNA polymerase to activate transcription from target promoters .

What are the key challenges in expressing recombinant CbrB protein?

Expression of membrane-associated proteins like CbrB presents several challenges. While some membrane proteins accumulate to high levels, closely related proteins are barely detected, suggesting complex factors affecting expression efficiency . The stress response triggered in host cells during membrane protein overexpression is a significant factor limiting yields . When expressing CbrB, researchers should consider that the cell response to membrane protein production affects numerous genes that are either upregulated or downregulated, potentially limiting yields of membrane-inserted protein . Additionally, as CbrB interacts with the membrane-bound CbrA sensor, proper folding and maintaining native conformation is essential for functional studies.

How do host cell stress responses affect CbrB expression yields?

The successful overproduction of membrane proteins like CbrB has been linked to the avoidance of stress responses in the host cell . During recombinant expression, host cells often upregulate stress-response genes while downregulating genes essential for protein production when yields of membrane-inserted protein are poor . This stress response can lead to growth arrest, limited protein synthesis, and even cell death. For CbrB expression, selecting appropriate host strains, optimizing growth conditions, and using tightly controlled induction systems can help mitigate these stress responses and improve yields.

What structural elements of CbrB are critical for its DNA-binding function?

CbrB recognizes a specific palindromic nucleotide sequence in the UAS of promoters it regulates . Mutational analysis of the crcZ promoter and in vitro electrophoretic mobility shift assays using crcZ promoter fragments and purified CbrB protein have confirmed this recognition sequence . The consensus CbrB recognition sequence shows similarity to the NtrC recognition sequence . Understanding these structural elements is critical when designing experiments to study CbrB-DNA interactions or when creating recombinant versions of CbrB that maintain native DNA-binding activity.

What expression systems are most effective for recombinant CbrB production?

Based on research with other inner membrane proteins, E. coli-based expression systems remain the workhorses for recombinant membrane protein production. For CbrB specifically, a truncated version at the N-terminus has been successfully purified and used in electrophoretic mobility shift assays . For optimal expression, consider using specialized E. coli strains designed for membrane protein expression. Evidence from outer membrane protein expression shows that deletion mutant strains can significantly improve production levels . For example, the BL21ΔABCF strain has demonstrated improved production of various outer membrane proteins compared to traditional BL21(DE3) strains .

What purification strategies yield the highest purity and activity of recombinant CbrB?

Based on limited information in the search results, recombinant His-tagged CbrB has been successfully purified using immobilized metal affinity chromatography (IMAC), with elution achieved using 175 mM imidazole . The purity was verified by SDS-PAGE analysis . When designing a purification protocol for CbrB, researchers should consider:

  • Solubilization method: Appropriate detergents for membrane protein extraction

  • Buffer optimization: pH, salt concentration, and additives that maintain protein stability

  • Chromatography sequence: Following IMAC with size exclusion or ion exchange chromatography

  • Quality control: Analytical methods to assess purity, homogeneity, and structural integrity

Table 1: Recommended purification conditions for recombinant CbrB

Purification StepConditionsKey Considerations
Cell lysisMechanical disruption or mild detergentsPreserve native structure
IMACNi-NTA with 175 mM imidazole elutionMonitor purity by SDS-PAGE
Size exclusionBuffer containing stabilizing agentsAssess oligomeric state
ConcentrationCentrifugal concentratorsAvoid protein aggregation

How can the functional activity of purified CbrB be assessed?

The functionality of purified recombinant CbrB can be assessed through several complementary approaches:

  • DNA-binding assays: Electrophoretic mobility shift assays (EMSAs) using crcZ promoter fragments containing the palindromic recognition sequence

  • In vitro transcription assays: Using purified σ54 RNA polymerase and appropriate target promoters

  • Phosphorylation assays: To verify that CbrB can be properly phosphorylated, either by CbrA or by small molecule phosphate donors

  • Structural verification: Circular dichroism spectroscopy to confirm secondary structure elements

For EMSAs specifically, researchers should use the identified palindromic sequence located in the UAS of the crcZ promoter as a positive control for binding .

Why does recombinant CbrB expression often result in low yields, and how can this be optimized?

Low yields of recombinant membrane proteins like CbrB can be attributed to several factors:

  • Cellular stress responses: Host cells often respond to membrane protein overexpression by triggering stress responses that limit protein synthesis

  • Membrane insertion limitations: The translocon machinery may become saturated during overexpression

  • Protein misfolding and degradation: Incorrectly folded proteins are targeted for degradation

To optimize expression yields:

  • Use specialized expression strains: Consider deletion mutants like those developed for outer membrane proteins

  • Optimize induction conditions: Lower temperature (30°C) and reduced inducer concentration can improve folding

  • Co-express chaperones: This can assist with proper folding and membrane insertion

  • Use fusion partners: These can enhance solubility and facilitate proper targeting

Table 2: Optimization strategies for recombinant CbrB expression

ParameterStandard ConditionOptimized ConditionExpected Improvement
Growth temperature37°C30°CReduced aggregation and improved folding
Inducer concentration1 mM IPTG0.1-0.5 mM IPTGSlower expression rate, improved folding
Media compositionLBSupplemented with specific ionsEnhanced membrane integrity and insertion
Expression strainBL21(DE3)Specialized deletion strainsReduced cellular stress, improved yields

How can researchers troubleshoot protein-DNA binding issues in CbrB functional studies?

When encountering difficulties with CbrB-DNA binding experiments:

  • Verify protein activity: Ensure that purified CbrB maintains its native conformation and has not been damaged during purification

  • Optimize binding conditions: Test various buffer compositions, including different pH values, salt concentrations, and additives like magnesium ions

  • Confirm DNA sequence integrity: Ensure that the palindromic recognition sequence is intact and properly positioned in the DNA construct

  • Consider co-factors: Integration host factor (IHF) is required for crcZ expression , suggesting it may enhance CbrB-DNA interactions

  • Assess phosphorylation status: CbrB likely requires phosphorylation for optimal DNA binding activity

What are the critical controls needed when studying CbrB-regulated promoters?

When investigating CbrB-regulated promoters, these essential controls should be included:

  • Positive control: Use the well-characterized crcZ promoter with its intact palindromic sequence

  • Negative control: Use a mutated version of the recognition sequence or an unrelated promoter fragment

  • Phosphorylation control: Compare binding activity of phosphorylated versus non-phosphorylated CbrB

  • Concentration series: Perform assays with varying concentrations of CbrB to determine binding affinity

  • Competition assays: Use unlabeled DNA fragments to verify binding specificity

DNA sequences for controls should include the consensus palindromic sequence identified in the crcZ promoter, which has similarity to the NtrC recognition sequence .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.