Recombinant Inner membrane protein yaaH (yaaH)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of Inner Membrane Protein yaaH

Inner membrane protein yaaH, also known as satP (succinate-acetate/proton symporter), is a transmembrane protein primarily found in bacterial species. The protein functions as a symporter, facilitating the transport of succinate and acetate across the bacterial inner membrane coupled with proton movement . In Escherichia coli, the full-length yaaH protein consists of 188 amino acids and has been identified as an integral component of the bacterial inner membrane architecture . The protein contains multiple transmembrane domains that anchor it within the lipid bilayer, allowing it to perform its transport functions effectively.

The yaaH protein has been characterized in several bacterial species, including Escherichia coli, Shigella flexneri, and Bacillus subtilis, with varying degrees of sequence conservation across these organisms . In Bacillus subtilis, the yaaH gene has been identified as part of the SigE regulon, which plays a crucial role in the bacterial sporulation process . This indicates that while the core transport function may be conserved, the regulatory mechanisms and physiological roles of yaaH may differ across bacterial species.

Nomenclature and Identification

The protein is recorded in scientific databases under several synonyms, reflecting its identification across different research contexts. These synonyms include:

  • yaaH (the original gene designation)

  • satP (functional designation as succinate-acetate/proton symporter)

  • Z0010 and ECs0010 (strain-specific identifiers)

  • Succinate-acetate transporter protein (functional description)

The protein is registered in the UniProt database with the identifier P0AC99, which serves as the reference point for protein sequence and functional annotation data .

Predicted Membrane Topology

Based on the amino acid sequence, the yaaH protein is predicted to contain multiple transmembrane helices that span the bacterial inner membrane. These hydrophobic domains are interconnected by hydrophilic loops that may play roles in substrate recognition and binding. The arrangement of these transmembrane domains creates a channel or pore through which the substrates (succinate and acetate) and protons can be transported.

The recent advancements in protein structure prediction using artificial intelligence tools such as AlphaFold3 have significantly enhanced our ability to visualize and understand the three-dimensional structure of membrane proteins like yaaH . While specific AlphaFold3 predictions for yaaH are not detailed in the search results, the technology represents a valuable tool for further structural characterization of this protein.

Transcriptional Regulation

In Bacillus subtilis, the yaaH gene has been identified as part of the SigE regulon . SigE is an RNA polymerase sigma factor that plays a crucial role in the regulation of genes expressed during the early stages of bacterial sporulation. Northern blot analysis has revealed that yaaH mRNA is first detected at a specific point during the sporulation process, suggesting a temporally regulated expression pattern .

The yaaH promoter region contains specific sequence elements that are recognized by the SigE RNA polymerase. Studies have used primer extension assays with digoxigenin-end-labeled primers specific for sequences around the BamHI site and the lacZ gene of pMutinT3 to detect yaaH transcription . These analyses have confirmed that the gene is specifically transcribed by the SigE RNA polymerase, providing insights into its regulation.

Functional Role in Bacterial Physiology

Based on similarity analysis of primary structure and transcriptional studies, researchers have concluded that YaaH is a specific component of the system involved in l-alanine-related processes . In Bacillus subtilis, this function appears to be particularly important during sporulation, suggesting a specialized role in this developmental process.

The identification of yaaH as a succinate-acetate/proton symporter (satP) in Escherichia coli indicates its primary role in the transport of these organic acids across the bacterial membrane . This function is crucial for bacterial metabolism, particularly in environments where these organic acids serve as carbon sources or need to be exported as metabolic byproducts.

Expression Systems and Purification

Recombinant Inner membrane protein yaaH is commercially produced using bacterial expression systems, primarily Escherichia coli . The full-length protein (amino acids 1-188) is typically expressed with fusion tags, such as an N-terminal histidine tag, to facilitate purification and detection . The expression in E. coli allows for the production of significant quantities of the protein for research and commercial applications.

The purification of recombinant yaaH typically involves:

  1. Expression in suitable E. coli strains

  2. Cell lysis and membrane fraction isolation

  3. Solubilization of membrane proteins using appropriate detergents

  4. Affinity chromatography utilizing the histidine tag

  5. Further purification steps as needed to achieve high purity

Commercial preparations of recombinant yaaH protein typically achieve purity levels greater than 90% as determined by SDS-PAGE analysis .

yaaH Protein in Protein Function Prediction Research

The yaaH protein is included in datasets used for protein function prediction research, particularly in the context of bacterial proteins . These datasets are crucial for developing and testing computational methods for predicting protein functions based on sequence, structure, and other features.

One such dataset includes 171,212 reviewed prokaryotic proteins with extracted features and Gene Ontology (Molecular Function) annotations . These proteins are characterized by 9,890 attributes for each sequence, along with 1,739 Gene Ontology terms. The dataset allows researchers to develop machine learning models for protein function prediction, which is particularly valuable for membrane proteins like yaaH that can be challenging to characterize experimentally.

Features extracted for proteins in these datasets typically include:

  • Sequence-based features (amino acid compositions, dipeptide compositions, tripeptide compositions)

  • Physicochemical properties

  • Secondary structure predictions

  • Annotation-based features

These comprehensive datasets facilitate the development of advanced computational tools for predicting protein functions, which can supplement experimental approaches and accelerate research on proteins like yaaH.

Applications of AI in yaaH Structure Prediction

The field of AI-driven protein structure prediction has seen significant advancements, particularly with the release of tools like AlphaFold3 in 2024 . These tools offer the ability to predict not just isolated protein structures but also molecular complexes, which is particularly valuable for membrane proteins like yaaH that function through interactions with other molecules.

The application of these advanced AI tools to predict the structure of yaaH and its complexes with substrates such as succinate and acetate could provide valuable insights into the mechanism of transport. Additionally, the prediction of yaaH interactions with other proteins could reveal previously unknown functional relationships and regulatory mechanisms.

Functional Characterization Across Bacterial Species

While yaaH has been identified and characterized in several bacterial species, including Escherichia coli, Shigella flexneri, and Bacillus subtilis, there remains significant scope for comparative studies across a broader range of bacteria . Such studies could reveal evolutionary adaptations in the protein's structure and function, providing insights into bacterial metabolism and physiology.

The role of yaaH in bacterial sporulation, particularly in Bacillus subtilis, represents an interesting area for further investigation . Understanding how this membrane transporter contributes to the complex developmental process of sporulation could reveal new aspects of bacterial adaptation and survival strategies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your application.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
satP; yaaH; SF0011; S0010; Succinate-acetate/proton symporter SatP; Succinate-acetate transporter protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Shigella flexneri
Target Names
satP
Target Protein Sequence
MGNTKLANPAPLGLMGFGMTTILLNLHNVGYFALDGIILAMGIFYGGIAQIFAGLLEYKK GNTFGLTAFTSYGSFWLTLVAILLMPKLGLTDAPNAQFLGVYLGLWGVFTLFMFFGTLKG ARVLQFVFFSLTVLFALLAIGNIAGNAAIIHFAGWIGLICGASAIYLAMGEVLNEQFGRT VLPIGESH
Uniprot No.

Target Background

Function
Function: Acetate and succinate uptake. Transport is energetically coupled to the proton motive force.
Database Links

KEGG: sfl:SF0011

Protein Families
Acetate uptake transporter (AceTr) (TC 2.A.96) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the YaaH protein and to which protein family does it belong?

The YaaH protein belongs to the GPR1/FUN34/YaaH (GFY) protein superfamily, which consists of membrane channels with structural homology to bacterial succinate-acetate channels . These proteins are found across various organisms, including bacteria such as Escherichia coli where YaaH functions as an inner membrane protein . In eukaryotic microorganisms like Chlamydomonas reinhardtii, GFY family proteins have been implicated in acetate transport and metabolism, with expression levels increasing significantly upon acetate addition to the culture medium .

What is the primary function of YaaH in bacterial systems?

Based on structural homology studies with other members of the GFY protein family, YaaH likely functions as a membrane channel involved in the transport of small organic acids, particularly acetate and/or succinate . Research on homologous proteins suggests that YaaH may play a role in acetate metabolism, potentially facilitating the movement of acetate across the inner membrane of E. coli . This functionality is particularly important in metabolic pathways involving acetate utilization or production, which are central to bacterial energy metabolism under various growth conditions.

How does the structure of YaaH relate to its function?

YaaH shares structural features with bacterial succinate-acetate channels, suggesting a conserved mechanism for small organic acid transport . The protein is embedded in the inner membrane of E. coli with multiple transmembrane domains forming a channel-like structure . Structural models indicate specific residues that likely form the channel pore and contribute to substrate specificity. The transmembrane arrangement facilitates the controlled passage of acetate or succinate across the phospholipid bilayer, enabling the cell to regulate the internal concentration of these metabolites based on environmental conditions and metabolic requirements.

What are the optimal conditions for expressing recombinant YaaH protein in E. coli?

For expressing recombinant membrane proteins like YaaH in E. coli, a multivariant experimental design approach is recommended to determine optimal conditions . Key parameters to consider include:

  • Induction absorbance: The optimal cell density for induction significantly affects protein yield (p<0.0001)

  • IPTG concentration: While high concentrations can reduce cell growth (p=0.0387), this parameter shows less impact on protein activity (p=0.5422)

  • Expression temperature: This critically affects both cell growth (p<0.0001) and protein activity (p=0.0011)

  • Medium composition: Tryptone concentration significantly impacts both protein activity (p=0.0061) and process productivity (p=0.0095)

For membrane proteins like YaaH, lower expression temperatures (below 30°C) often result in better folding and membrane integration, despite potentially slower growth rates. The composition of the culture medium, particularly the tryptone content, plays a significant role in enhancing the expression of functional protein.

How can I optimize the soluble expression of YaaH using statistical experimental design?

Statistical experimental design methodology provides a powerful approach to optimize soluble expression of membrane proteins like YaaH . Instead of the traditional univariant method (changing one variable at a time), use a multivariant factorial design that:

  • Evaluates multiple variables simultaneously

  • Accounts for interactions between variables

  • Characterizes experimental error

  • Normalizes variables for direct comparison of effects

  • Minimizes the number of experiments needed

For YaaH expression, implement a fractional factorial screening design (such as 2^8-4 with central point replicates) to assess the effects of variables like induction absorbance, IPTG concentration, expression temperature, and medium components . This approach enables systematic optimization of culture conditions to achieve high levels of soluble, functional protein while reducing operational costs and experimental time.

The following table presents an example of statistical analysis results for key parameters in recombinant protein expression:

ParameterCell growth
Effect
Cell growth
p-value
Protein activity
Effect
Protein activity
p-value
Process productivity
Effect
Process productivity
p-value
Induction absorbance1.43<0.0001323.50.00160.330.2248
IPTG-0.420.0387-52.00.5422-0.190.4720
Expression temperature1.13<0.0001-340.80.0011-0.910.0041
Yeast extract0.860.000477.00.37060.230.3930
Tryptone0.670.0027268.20.00610.790.0095
Glucose-0.330.0920164.30.06850.370.1797

What expression vectors are most suitable for recombinant YaaH production?

For membrane proteins like YaaH, specialized expression vectors that enable controlled expression are essential . Consider vectors with:

  • Tunable promoters: The tightly regulated T7 expression system allows precise control over expression levels, preventing premature protein synthesis that could lead to toxicity or inclusion body formation

  • Fusion tags: N-terminal tags like MBP (maltose-binding protein) can enhance solubility, while C-terminal His6 tags facilitate purification without interfering with membrane insertion

  • Signal sequences: For proper membrane targeting and insertion, include appropriate signal sequences that direct the protein to the E. coli inner membrane

  • Compatibility with secretion machinery: For optimal membrane integration, consider compatibility with secretion systems like Bam and Tam complexes that facilitate proper folding and insertion of β-barrel proteins

When selecting a vector system, balance high expression levels with proper folding and membrane integration to avoid inclusion body formation, which is particularly challenging for membrane proteins like YaaH.

How can I verify the proper membrane localization of recombinantly expressed YaaH?

Verification of proper membrane localization for YaaH requires multiple complementary approaches:

  • Subcellular fractionation: Separate inner membrane, outer membrane, cytoplasmic, and periplasmic fractions using differential centrifugation and osmotic shock procedures

  • Western blot analysis: Use anti-YaaH antibodies or antibodies against fusion tags to detect the protein in membrane fractions following SDS-PAGE separation

  • Fluorescence microscopy: Create GFP fusion constructs to visualize membrane localization in vivo, similar to approaches used for homologous GFY proteins in Chlamydomonas

  • Protease accessibility assays: Use proteases that cannot penetrate intact membranes to determine the orientation and topology of YaaH within the membrane

  • Membrane protein extraction: Solubilize the protein using appropriate detergents (e.g., n-dodecyl-β-D-maltoside) and verify its presence in the detergent-soluble fraction

Proper membrane localization is critical for functional studies, as mislocalized protein will not exhibit native activities in functional assays.

What approaches can be used to study the channel activity of YaaH?

To characterize the channel activity of YaaH as a potential succinate-acetate transporter, employ these methodological approaches:

  • Proteoliposome-based transport assays: Reconstitute purified YaaH into liposomes and measure the uptake or efflux of radiolabeled substrates (acetate, succinate) across the membrane

  • Whole-cell uptake assays: Compare substrate uptake rates between wild-type cells and YaaH-overexpressing or knockout strains

  • Patch-clamp electrophysiology: For detailed biophysical characterization, perform single-channel recordings to determine conductance properties and substrate selectivity

  • Growth complementation studies: Test whether YaaH expression can restore growth of transport-deficient mutants on media containing acetate or succinate as the sole carbon source

  • pH-sensitive fluorescent probes: Monitor changes in internal pH upon substrate addition to cells or proteoliposomes containing YaaH to detect proton-coupled transport

The combined results from these approaches can establish the substrate specificity, transport kinetics, and regulatory mechanisms controlling YaaH channel activity.

How does the Bam complex interact with membrane proteins like YaaH during membrane integration?

The Bam (β-barrel assembly machinery) complex plays a crucial role in the integration of membrane proteins, particularly those with β-barrel domains . For membrane proteins like YaaH:

  • Initial recognition: BamA recognizes specific sequence motifs in the C-terminal region of the β-barrel domain of the substrate protein

  • β-strand interaction: The first and last β-strands of the nascent β-barrel interact with the lateral gate of BamA, as demonstrated by cross-linking experiments

  • Sequential folding: The nascent β-barrel is folded and inserted into the membrane through a process involving sequential strand incorporation

  • Species specificity: The BamA recognition motif shows species-specific variations that may affect the expression of non-native membrane proteins

Cross-linking experiments have revealed contacts between stalled autotransporter mutants and BamA, BamB, and BamD components, indicating multiple interaction points during membrane integration . For YaaH studies, consider the potential role of these interactions when expressing the protein in heterologous systems, as non-native membrane proteins may interact sub-optimally with the host Bam complex.

What is the role of the TamA/TamB system in YaaH membrane integration, and how does it differ from the Bam complex?

The TamA/TamB system represents an alternative pathway for membrane protein integration that may complement the Bam complex for certain substrates :

  • Structural similarities: TamA, like BamA, contains a 16-stranded β-barrel with a lateral gate formed by the first and last β-strands

  • Distinct components: TamA interacts with TamB, which features a periplasmic domain with a hydrophobic groove that can accommodate membrane protein segments

  • Mechanical action: The POTRA domains of TamA form a rigid lever arm that moves in the presence of unfolded substrates and pushes onto TamB, potentially generating force to push the outer membrane outward

  • Substrate specificity: Not all membrane proteins depend on TamA for membrane integration; for example, some autotransporters like Hbp and EspP are efficiently secreted in ΔtamA strains

For YaaH research, determining whether the protein relies on TamA, BamA, or both systems for proper membrane integration would provide valuable insights into its biogenesis pathway. This could be accomplished through expression studies in strains with deletions or depletions of components from either system.

How can computational modeling enhance our understanding of YaaH structure-function relationships?

Advanced computational approaches offer powerful tools for studying membrane proteins like YaaH:

  • Homology modeling: Generate structural models of YaaH based on homologous proteins with known structures from the GFY family

  • Molecular dynamics simulations: Simulate the behavior of YaaH within a lipid bilayer to understand conformational changes associated with channel opening and closing

  • Substrate docking: Perform in silico docking of potential substrates (acetate, succinate) to identify key residues involved in substrate recognition and transport

  • Evolutionary analysis: Conduct comparative genomics across GFY family members to identify conserved functional residues and species-specific adaptations

  • Machine learning approaches: Apply neural network-based prediction tools to identify functional motifs and potential post-translational modifications

These computational approaches can guide experimental design by identifying critical residues for mutagenesis studies and predicting functional properties that can be tested experimentally. For YaaH specifically, comparing structural models with known succinate-acetate channels could reveal the molecular basis for substrate specificity.

How might YaaH and related GFY proteins be exploited for biotechnological applications?

The potential biotechnological applications of YaaH and related GFY proteins include:

  • Metabolic engineering: Modulating acetate transport via YaaH could optimize acetate utilization or secretion in engineered bacterial strains for bioproduction

  • Biosensors: YaaH-based biosensors could be developed to detect extracellular organic acids in environmental or industrial samples

  • Protein display systems: Similar to other membrane proteins, YaaH could potentially serve as a scaffold for surface display of recombinant proteins

  • Membrane protein production platform: Insights gained from YaaH expression could improve heterologous membrane protein production systems

  • Drug delivery vehicles: Modified membrane channels could facilitate the delivery of small molecules across biological membranes

For these applications, understanding the structure-function relationships and developing efficient expression systems for YaaH is essential. The experimental design approaches discussed earlier would be valuable for optimizing YaaH expression for these biotechnological purposes.

What are the current challenges in studying YaaH and other membrane proteins, and how might they be addressed?

Current challenges in membrane protein research that apply to YaaH include:

  • Expression obstacles: Membrane proteins often express poorly or form inclusion bodies; addressing this requires systematic optimization of expression conditions through multivariant experimental design

  • Structural characterization: Obtaining high-resolution structures of membrane proteins remains challenging; emerging techniques like cryo-electron microscopy and integrative structural biology approaches may overcome these limitations

  • Functional reconstitution: Maintaining native activity after purification and reconstitution requires careful selection of detergents and lipid compositions

  • Heterologous expression compatibility: Species-specific variations in membrane insertion machinery may affect proper folding and activity; using phylogenetically related expression hosts may mitigate this issue

  • Post-translational modifications: Understanding if YaaH requires specific modifications for function that might be missing in heterologous systems

Addressing these challenges requires interdisciplinary approaches combining molecular biology, biochemistry, biophysics, and computational methods. The development of novel membrane-mimetic systems and advanced imaging techniques will continue to enhance our ability to study membrane proteins like YaaH.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.