Recombinant Inner membrane protein yagU (yagU)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yagU; Z0353; ECs0317; Inner membrane protein YagU
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
yagU
Target Protein Sequence
MNIFEQTPPNRRRYGLAAFIGLIAGVVSAFVKWGAEVPLPPRSPVDMFNAACGPESLIRA AGQIDCSRNFLNPPYIFLRDWLGLTDPNAAVYTFAGHVFNWVGVTHIIFSIVFAVGYCVV AEVFPKIKLWQGLLAGALAQLFVHMISFPLMGLTPPLFDLPWYENVSEIFGHLVWFWSIE IIRRDLRNRITHEPDPEIPLGSNR
Uniprot No.

Target Background

Database Links

KEGG: ece:Z0353

STRING: 155864.Z0353

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are commonly used for recombinant yagU production?

E. coli is the predominant expression system for recombinant yagU production, as it allows for homologous expression of this bacterial membrane protein . Common E. coli expression approaches include:

  • Direct cytoplasmic expression: Using strong promoters like T7 with appropriate fusion tags

  • Membrane-targeted expression: Employing pelB or other leader sequences to target the protein to the bacterial membrane

  • Autoinduction systems: Modified autoinduction protocols that help moderate expression levels to prevent inclusion body formation

For example, search result describes a successful membrane protein expression approach that uses "a short pelB leader sequence to target the proteins to the bacterial membrane, a modified autoinduction expression method, use of mild OG and comparable detergents to extract the proteins from membranes, and optimized IMAC purification conditions."

How should I design my vectors for optimal yagU expression?

When designing expression vectors for yagU, consider the following key elements:

Vector ElementRecommendationRationale
Promoter strengthModerate to low (e.g., tac, araC, or synthetic trc)Strong promoters like T7 may lead to inclusion body formation due to excessive expression rates
Copy numberLow copy number (0-50 copies/cell)High copy number plasmids increase metabolic burden and protein aggregation risk
Fusion tagsN-terminal or C-terminal His-tagFacilitates purification via IMAC without significantly affecting structure
Signal sequencepelB or similar leader sequenceDirects the protein to the membrane during expression
Antibiotic resistanceAmpicillin or kanamycinStandard selection markers for maintaining plasmid stability

As stated in search result : "A high copy number generally corresponds to 100 copies/cell, while a low copy number is anywhere from 0 to 50 copies/cell. High copy number expression plasmids can lead to inclusion bodies formation due to the high rate of heterogeneous protein expression, thus a low copy number plasmid is more beneficial to yield soluble proteins."

What purification strategies are most effective for obtaining high-purity recombinant yagU?

Purification of membrane proteins like yagU requires specialized approaches to maintain protein stability and native conformation. Based on the search results, an effective purification workflow includes:

  • Membrane isolation: Use hypotonic lysis followed by differential centrifugation to isolate membrane fractions

  • Solubilization: Extract yagU from membranes using mild detergents like octyl glucoside (OG)

  • Affinity purification: Purify His-tagged yagU using immobilized metal affinity chromatography (IMAC)

  • Size exclusion chromatography: Further purify the protein and remove aggregates

  • Quality assessment: Confirm purity via SDS-PAGE and Western blotting using anti-His antibodies or yagU-specific antibodies

A reproducible membrane protein purification method described in search result yielded "an average yield of membrane proteins was 237 μg/10 million cells" with "highly pure membrane fraction" confirmed by Western blot and LC-MS/MS analysis.

How can I confirm the proper folding and membrane integration of recombinant yagU?

Confirming proper folding and membrane integration of yagU requires multiple complementary techniques:

  • Semi-native PAGE: Compare migration patterns between detergent-solubilized and reconstituted proteins; properly folded membrane proteins often show characteristic migration patterns

  • Protease protection assays: Incubate reconstituted proteoliposomes with proteases to determine which regions are protected (membrane-embedded) versus exposed

  • Tryptophan fluorescence spectroscopy: Monitor intrinsic fluorescence changes that reflect tertiary structure formation

  • Circular dichroism (CD): Assess secondary structure content, particularly α-helical content typical of many membrane proteins

  • Dynamic light scattering (DLS): Confirm homogeneous reconstitution in proteoliposomes

As noted in search result : "DLS measurements confirmed the presence of a monodisperse population with radii in the range of large unilamellar vesicles (∼80 nm)," providing evidence of successful membrane protein reconstitution.

What are the key challenges in reproducing yagU expression and purification experiments?

Reproducibility challenges in membrane protein research, including work with yagU, stem from several factors:

  • Expression variability: Small changes in culture conditions can significantly impact membrane protein yields and folding

  • Membrane isolation consistency: Different cell disruption methods create varying degrees of membrane fragmentation, affecting extraction efficiency

  • Detergent effects: Batch-to-batch variation in detergents can influence solubilization efficiency and protein stability

  • Post-translational modifications: Inconsistent processing of leader sequences or other modifications

  • Oligomerization state variability: Membrane proteins may form different oligomeric states depending on purification conditions

Search result notes that "Bead beating, Polytron® homogenizer, Dounce® homogenizer, needle, nitrogen cavitation, and French press all create reproducibility issues due to an inability for batch processing. On the contrary, sonication is amenable to batch processing, but it produces moderate to fine cell debris, causing irreproducible membrane isolation in downstream steps."

To improve reproducibility, implement standardized protocols with detailed documentation of all parameters and use consistent reagent sources.

How can I determine if recombinant yagU forms oligomeric structures in membranes?

Determining the oligomeric state of membrane proteins like yagU requires sophisticated biophysical techniques:

  • Chemical crosslinking: Use membrane-permeable crosslinkers followed by SDS-PAGE and Western blotting to identify potential oligomeric species

  • Blue native PAGE (BN-PAGE): Analyze native protein complexes while maintaining quaternary structures

  • Analytical ultracentrifugation (AUC): Determine molecular weight and stoichiometry of membrane protein complexes in detergent

  • Multi-angle light scattering (MALS): Measure absolute molecular weight of proteins in solution

  • Atomic force microscopy (AFM): Directly visualize protein organization in reconstituted membranes

Search result describes how "semi-native electrophoresis showed that when UCP4 [another membrane protein] was reconstituted, all monomers self-associated into tetramers," demonstrating how this technique can reveal oligomerization behaviors. Similar approaches could determine whether yagU forms oligomers like other membrane proteins.

What reconstitution systems best preserve the native structure and function of yagU?

Choosing appropriate reconstitution systems is critical for maintaining the native structure and function of membrane proteins like yagU:

Reconstitution SystemAdvantagesApplications
LiposomesMost natural membrane mimetic; suitable for functional assaysFunctional characterization; antibody generation
NanodiscsDefined size; access to both protein faces; detergent-freeStructural studies; single-molecule assays
AmphipolsHigh stability; compatible with many biophysical techniquesCryo-EM; spectroscopic studies
Lipid cubic phasesSupport crystal growth; maintain native environmentX-ray crystallography

Search result describes successful reconstitution of membrane proteins in egg yolk phosphatidylcholine (PC) liposomes: "Egg yolk PC (about 60% PC) was chosen as it contains other forms of phospholipids (such as PE) that are also found in the MIM [mitochondrial inner membrane]."

The lipid composition significantly impacts reconstitution success. Consider using E. coli lipid extracts or synthetic lipid mixtures that mimic the bacterial inner membrane composition for yagU reconstitution.

How can I design experiments to elucidate the functional role of yagU in membrane protein biogenesis?

Designing experiments to investigate yagU's potential role in membrane protein biogenesis requires multifaceted approaches:

  • Genetic studies:

    • Create yagU knockout strains and assess effects on membrane protein expression

    • Complement with wild-type and mutant yagU to identify critical residues

    • Analyze synthetic lethality with other membrane biogenesis factors

  • Protein-protein interaction studies:

    • Perform co-immunoprecipitation with known membrane insertion machinery components

    • Use bacterial two-hybrid assays to screen for interaction partners

    • Apply proximity labeling techniques (e.g., BioID) to identify neighboring proteins in vivo

  • In vitro reconstitution assays:

    • Develop cell-free translation systems supplemented with yagU-containing liposomes

    • Assess membrane insertion efficiency of model substrates in the presence/absence of yagU

    • Monitor changes in membrane properties upon yagU incorporation

  • Structural studies:

    • Generate computational models of yagU structure

    • Analyze for potential substrate-binding regions similar to known insertases like YidC

Search result describes an insertase function for a glycolipid called MPIase: "MPIase functions at an initial step of protein integration into the membrane, while YidC allows complete insertion at a later step." This provides a conceptual framework for investigating whether yagU might play a similar role in membrane protein biogenesis.

What statistical approaches are most appropriate for analyzing yagU expression data in microarray or proteomics studies?

  • Experimental design considerations:

    • Implement randomization, replication, and blocking as fundamental principles

    • Include both biological and technical replicates with emphasis on biological replication

    • Use linear or mixed-effects linear modeling approaches that incorporate experimental design

  • Data analysis workflow:

    • Apply appropriate normalization methods for your platform

    • Use moderated t-tests or F-tests as part of mixed-effects linear models

    • Control for multiple testing using False Discovery Rate (FDR) methods

  • Interpreting correlation between mRNA and protein levels:

    • Consider measurement reproducibility when analyzing correlations

    • Evaluate protein-specific reproducibility scores that may impact observed correlations

    • Remember that "proteins with more reproducible measurements tend to have a higher mRNA-protein correlation"

Search result notes: "The use of linear or mixed-effects linear modeling strategies provides a general framework for data analysis that naturally incorporates experimental design... Mixed-effects linear models are 'mixed' in that they include both fixed and random effects. The fixed effects specify the mean of the response variable as a function of treatment conditions of interest. The random effects specify the correlation structure among observations."

How can I develop recombinant yagU proteoliposomes for vaccine or immunological studies?

Developing yagU proteoliposomes for immunological applications requires careful consideration of protein conformation and presentation:

  • Optimized proteoliposome preparation:

    • Use cell-free expression systems in the presence of liposomes for direct incorporation

    • Select lipid compositions that promote native protein folding

    • Verify protein orientation using protease protection assays

  • Immunogenicity characterization:

    • Evaluate antibody responses to different immunization routes (e.g., intranasal vs. subcutaneous)

    • Assess antibody isotype profiles (IgG, IgG1, IgG2a, IgM, IgA) to characterize immune response quality

    • Monitor mucosal immunity development through tissue-specific IgA levels

  • Adjuvant selection:

    • Test CpG for intranasal immunization and Freund's adjuvants for subcutaneous delivery

    • Compare immune response profiles between adjuvant combinations

Search result describes that "BALB/c mice were immunized with recombinant protein at a dose of 50 µg/mouse plus adjuvant (CpG for the intranasal group or Freund's complete adjuvant (CFA) or Freund's incomplete adjuvant (IFA) for the subcutaneous group)." This approach could be adapted for yagU proteoliposomes.

The same study found that "In the nasal cavity, an extremely high IgA response (p<0.001) was only detected in the group i.n. immunized with recombinant protein+CpG," highlighting the importance of administration route and adjuvant selection.

How do I troubleshoot inclusion body formation during recombinant yagU expression?

Inclusion body formation is a common challenge when expressing membrane proteins like yagU. Systematic troubleshooting approaches include:

  • Expression parameter optimization:

    • Reduce culture temperature (16-25°C) to slow protein synthesis and improve folding

    • Decrease inducer concentration to moderate expression rate

    • Consider weak promoters and low-copy number plasmids

  • Host strain engineering:

    • Use specialized E. coli strains designed for membrane protein expression

    • Consider strains with "decoupling of host cell growth from recombinant protein production"

    • Explore strains engineered to modulate transcription rates

  • Co-expression strategies:

    • Co-express molecular chaperones to assist in proper folding

    • Include components of membrane insertion machinery like YidC

  • Fusion partner approach:

    • Test solubility-enhancing fusion partners (e.g., MBP, SUMO)

    • Incorporate membrane-targeting sequences

Search result notes that "inclusion bodies (IBs) are nuclear, cytoplasmic, or periplasmic aggregates of bio-macromolecules, mostly proteins. These proteins are generally expressed from foreign or mutated genes without proper post-translational modifications and/or folding."

The same source recommends using "weak promoters and/or a low copy number plasmid" and mentions that "examples of such promoters for this purpose include the tac, araC, and synthetic trc promoters."

What are the latest technological advances in membrane protein structural characterization applicable to yagU?

Recent technological advances have expanded the toolkit for membrane protein structural characterization:

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for high-resolution structure determination without crystallization

    • Cryo-electron tomography to visualize proteins in their native membrane environment

    • Microcrystal electron diffraction (MicroED) for structure determination from nanoscale crystals

  • Advanced NMR techniques:

    • Solid-state NMR for membrane-embedded proteins

    • Selective isotope labeling strategies to reduce spectral complexity

    • Paramagnetic relaxation enhancement (PRE) for long-range distance constraints

  • Hybrid methods:

    • Integrative modeling approaches combining low-resolution and high-resolution data

    • Mass spectrometry-based methods like hydrogen-deuterium exchange (HDX) and crosslinking

    • Computational methods including AlphaFold2 for membrane protein structure prediction

  • Functional mapping:

    • Site-directed fluorescence labeling for conformational dynamics

    • Electrophysiology combined with structural methods

Search result highlights the impact of structural biology on membrane protein research: "Determination of membrane protein (MP) structures at atomic or near-atomic resolution plays a vital role in elucidating their structural and functional impact in biology. This endeavor has determined 1198 unique MP structures as of early 2021."

The same reference notes that "free access to MP structures facilitates broader and deeper understanding of MPs, which provides crucial new insights into their biological functions."

What are promising approaches for investigating potential interactions between yagU and other membrane biogenesis factors?

Several cutting-edge approaches can reveal functional relationships between yagU and other membrane components:

  • In vivo proximity labeling:

    • APEX2 or BioID fusion proteins to identify proximal interaction partners

    • Split-BioID systems to detect specific protein-protein interactions

    • Quantitative proteomics to compare interaction networks under different conditions

  • High-throughput genetic screens:

    • CRISPR interference screens to identify genetic interactions

    • Synthetic genetic array analysis with yagU as query gene

    • Transposon sequencing to identify genes with functional relationships to yagU

  • Reconstituted systems:

    • Cell-free translation systems with defined components

    • Stepwise reconstitution of membrane protein insertion machinery

    • Real-time fluorescence-based assays to monitor insertion kinetics

Search result describes that "a 'hydrophobic slide' is created between TMs 1, 2, and 5, while the hydrophilic environment generated by the groove can recruit the extracellular regions on substrates into the low-dielectric environment of the membrane, thus facilitating insertion." Similar structural features could be investigated in yagU to determine if it possesses insertase activity.

The search results also mention that "EmC uses spatially distinct yet coupled regions including lipid-accessible membrane cavities and cytosolic surfaces to function as an insertase for TA proteins and a protein holdase-chaperone for complex polytopic MPs," providing a conceptual framework for investigating yagU's potential role.

How might yagU function be elucidated through comparative analysis with other bacterial inner membrane proteins?

Comparative analysis approaches can provide insights into yagU function:

  • Phylogenetic profiling:

    • Identify co-evolved genes across bacterial species

    • Correlate presence/absence patterns with specific cellular processes

    • Map conservation of key residues across homologs

  • Structural comparison:

    • Identify structural homologs through fold recognition and threading

    • Compare with known membrane protein insertases like YidC

    • Analyze conserved motifs and potential substrate-binding regions

  • Functional complementation:

    • Test if yagU can complement defects in other membrane protein systems

    • Express yagU homologs from different bacteria in E. coli

    • Perform targeted mutagenesis of conserved residues

Search result describes YidC as having a "hydrophobic slide" created between transmembrane domains that facilitates insertion. Similarly, EMC (another insertase) uses "spatially distinct yet coupled regions including lipid-accessible membrane cavities and cytosolic surfaces to function as an insertase." These structural features provide templates for investigating whether yagU shares similar functional elements.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.