Recombinant Inner membrane protein yaiY (yaiY)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Inner Membrane Protein YaiY (YaiY)

Recombinant Inner Membrane Protein YaiY (yaiY) is a bioengineered version of the native YaiY protein, an integral inner membrane protein in Escherichia coli. Originally identified in genomic studies, YaiY is implicated in bacterial stress response pathways and envelope homeostasis . The recombinant form is produced via heterologous expression systems (e.g., E. coli), enabling research into its structural, functional, and pathological roles .

Sequence and Domains

YaiY consists of 102 amino acids (AA) with a predicted transmembrane topology. Key structural features include:

  • N-terminal signal sequence: MADFTLSKSLFSGKYRNASSTPGNIAYALFVLFCFWAGAQLLNLL

  • Core transmembrane segments: VGTIFGLIPFLVGCLIFAVVALWLHWRHRRQ .
    The protein lacks annotated catalytic motifs but shares homology with stress-responsive membrane proteins .

Amino Acid Sequence
1–50: MADFTLSKSLFSGKYRNASSTPGNIAYALFVLFCFWAGAQLLNLL
51–102: VGTIFGLIPFLVGCLIFAVVALWLHWRHRRQ

Recombinant Production

ParameterValue
SourceE. coli
TagN-terminal His-tag
LengthFull-length (1–102 AA)
Purity>90% (SDS-PAGE confirmed)
Storage BufferTris/PBS (pH 8.0) + 6% trehalose
ReconstitutionDeionized water (0.1–1.0 mg/mL)

Note: Commercial products (e.g., Creative Biomart, GeneBio Systems) recommend storing at -20°C/-80°C and avoiding repeated freeze-thaw cycles .

Stress Response Regulation

YaiY is transcriptionally induced under envelope stress, including ethanol, osmotic shock, and membrane-damaging agents . It interacts with Rcs and Cpx signaling pathways:

  • Rcs pathway: Activated by envelope stress, regulates capsule synthesis and biofilm formation .

  • Cpx pathway: Responsive to protein misfolding and membrane integrity disruptions .

Overexpression of YaiY triggers a mucoid phenotype by upregulating RcsB-dependent genes, suggesting a role in bacterial survival under hostile conditions .

Envelope Homeostasis

While YaiY lacks enzymatic activity, its structural role in maintaining membrane stability is critical:

  • Protein Quality Control: May assist in misfolded protein trafficking or degradation.

  • Stress Adaptation: Linked to antibiotic resistance mechanisms, though direct evidence remains limited .

Research Applications

  • Stress Response Studies: Analyze YaiY’s role in antibiotic resistance or host adaptation .

  • Structural Biology: Investigate transmembrane interactions via X-ray crystallography.

  • Drug Target Validation: Screen inhibitors for YaiY-dependent stress pathways.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will accommodate your request as much as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the solution for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
yaiY; c0484; Inner membrane protein YaiY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Target Names
yaiY
Target Protein Sequence
MADFTLSKSLFSGKYRNASSTPGNIAYALFVLFCFWAGAQLLNLLVHAPGVYERLMQVQE TGRPRVEIGLGVGTIFGLIPFLVGCLIFAVVALWLHWRHRRQ
Uniprot No.

Target Background

Database Links

KEGG: ecc:c0484

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the yaiY protein and what is known about its function?

The yaiY protein is an inner membrane protein found in Escherichia coli. While detailed functional characterization remains ongoing in the research community, it belongs to the broader class of bacterial membrane proteins that often play crucial roles in cellular processes such as transport, signaling, and maintaining membrane integrity. As a recombinant protein, it can be produced in expression systems to facilitate detailed biochemical and structural studies. The protein is commercially available through research suppliers for experimental investigations . Researchers typically approach functional characterization through complementary methods including genetic knockout studies, protein-protein interaction assays, and comparative genomics across bacterial species.

What expression systems are most suitable for recombinant yaiY production?

For bacterial membrane proteins like yaiY, several expression systems can be employed with varying degrees of success. E. coli-based expression systems are often the first choice due to the native origin of the protein, with BL21(DE3) strains being particularly useful when coupled with T7 promoter-based expression vectors. For challenging membrane proteins that may cause toxicity when overexpressed, inducible systems with tight regulation such as the arabinose-inducible pBAD system or tunable T7-based systems with lac operators provide better control. Expression optimization typically requires systematic testing of induction conditions (temperature, inducer concentration, and duration) to balance protein yield with proper folding and membrane integration.

How can I confirm the correct folding and membrane integration of recombinant yaiY?

Verification of proper folding and membrane integration is crucial for functional studies of yaiY. Multiple complementary approaches should be employed, including:

  • Cellular fractionation followed by Western blotting to confirm localization to the membrane fraction

  • Protease accessibility assays to determine topology of membrane-integrated protein

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Functional assays that depend on proper folding and orientation

  • Fluorescence-based approaches using GFP fusion constructs to monitor membrane targeting

These methods collectively provide confidence in the structural integrity of the recombinant protein before proceeding to more detailed analyses.

What purification strategies are recommended for yaiY protein?

Purification of membrane proteins like yaiY requires specialized approaches due to their hydrophobic nature. A typical workflow includes:

  • Membrane isolation through differential centrifugation following cell lysis

  • Solubilization using appropriate detergents (commonly DDM, LDAO, or Triton X-100)

  • Affinity chromatography using engineered tags (His6, FLAG, or Strep-tag II)

  • Size exclusion chromatography to ensure monodispersity and remove aggregates

  • Optional ion exchange chromatography for higher purity

The choice of detergent is particularly critical, as it must effectively extract the protein while maintaining its native conformation. Often, a detergent screening approach is necessary to identify optimal solubilization conditions for yaiY specifically.

What structural characterization methods are most suitable for yaiY protein analysis?

Structural studies of membrane proteins like yaiY present unique challenges due to their hydrophobicity and requirement for a membrane-mimetic environment. Researchers should consider multiple complementary approaches:

  • X-ray crystallography: Requires generation of well-diffracting crystals, often using lipidic cubic phase methods specifically developed for membrane proteins

  • Cryo-electron microscopy: Increasingly powerful for membrane protein structures without crystallization

  • Nuclear magnetic resonance (NMR): Suitable for dynamic analyses but generally limited to smaller membrane proteins or domains

  • Small-angle X-ray scattering (SAXS): Provides low-resolution structural information in solution

  • Molecular dynamics simulations: Computational approach to study protein behavior in membrane environments

Each method has distinct advantages and limitations when applied to inner membrane proteins like yaiY, with the choice depending on specific research questions and available resources.

How can I investigate potential interaction partners of yaiY in its native environment?

Understanding protein-protein interactions is essential for deciphering the functional role of yaiY. Several methodological approaches are available:

  • Co-immunoprecipitation with antibodies against yaiY or epitope-tagged versions

  • Bacterial two-hybrid systems adapted for membrane protein interactions

  • Chemical cross-linking followed by mass spectrometry (XL-MS)

  • Proximity labeling approaches such as BioID or APEX2

  • Surface plasmon resonance for in vitro validation of specific interactions

The YAP transcriptional regulator methodology, which has been successfully applied to identify protein complexes through genomic co-localization studies, could potentially be adapted to study yaiY interactions . Such approaches have revealed how YAP co-localizes with other factors like YY1 and EZH2 to regulate gene expression networks, and similar principles could be applied to membrane protein interaction studies.

What are the current challenges in structural determination of yaiY and similar membrane proteins?

Membrane protein structural biology faces several persistent challenges that researchers should consider when designing studies of yaiY:

  • Obtaining sufficient quantities of properly folded protein

  • Identifying suitable detergents or membrane mimetics that maintain native structure

  • Protein stability during purification and crystallization attempts

  • Generating well-diffracting crystals or high-quality samples for cryo-EM

  • Data interpretation in the context of artificial membrane environments

These challenges necessitate iterative optimization of expression, purification, and structural analysis protocols. Recent advances in cryo-EM and computational methods have improved success rates for membrane protein structural determination, but researchers should anticipate extensive troubleshooting.

How can computational approaches enhance experimental studies of yaiY?

Computational methods provide valuable complements to experimental approaches in yaiY research:

  • Homology modeling based on structurally characterized membrane proteins

  • Molecular dynamics simulations to predict protein behavior in membrane environments

  • Protein-protein interaction prediction algorithms

  • Functional annotation through evolutionary analysis and co-expression networks

  • Integration of experimental data with systems biology approaches

Similar to AI reliance frameworks that combine human and computational decision-making for optimal outcomes , modern membrane protein research benefits from integrating experimental and computational approaches. Such integration allows researchers to develop more targeted hypotheses and experimental designs.

What controls are essential when studying yaiY functional properties?

Robust experimental design for yaiY functional characterization requires appropriate controls:

Control TypePurposeImplementation
Expression levelsEnsure physiologically relevant conditionsWestern blot comparison with native expression
Membrane integrationVerify proper localizationFractionation controls, topological markers
Negative controlsRule out non-specific effectsEmpty vector, inactive mutants
Positive controlsValidate assay functionalityWell-characterized membrane proteins
Detergent controlsAccount for detergent effectsParallel testing of multiple detergents

These controls help distinguish genuine biological roles from artifacts introduced by experimental manipulation, ensuring reliable and reproducible results when studying yaiY function.

How should I design experiments to investigate yaiY regulation?

Investigation of yaiY regulation requires systematic experimental approaches:

  • Transcriptional regulation: Promoter analysis, reporter gene assays, and ChIP-seq to identify binding transcription factors

  • Post-translational modifications: Mass spectrometry analysis following immunoprecipitation

  • Protein stability and turnover: Pulse-chase experiments and degradation pathway inhibitors

  • Environmental regulation: Expression analysis under various stress conditions

  • Growth phase-dependent expression: Time-course sampling across bacterial growth curve

These approaches should be integrated to develop a comprehensive model of yaiY regulation in response to environmental and cellular cues.

What strategies are recommended for studying potential yaiY involvement in bacterial stress responses?

To investigate yaiY's potential role in stress responses, consider the following experimental design:

  • Gene expression analysis under different stress conditions (oxidative, osmotic, pH, antibiotic)

  • Phenotypic characterization of yaiY knockout/overexpression strains under stress

  • Protein abundance and modification changes during stress responses

  • Genetic interaction mapping with known stress response pathways

  • In vitro biochemical assays with purified protein under stress-mimicking conditions

Data should be collected across multiple timepoints and stress intensities to capture the dynamics of yaiY's potential stress response functions.

How should I approach conflicting data in yaiY functional studies?

When encountering conflicting results in yaiY research, employ a systematic troubleshooting approach:

  • Evaluate methodological differences between studies (expression systems, tags, purification methods)

  • Consider context-dependent effects (strain backgrounds, growth conditions, assay systems)

  • Assess protein quality and integrity across different preparations

  • Implement alternative complementary approaches to test the same hypothesis

  • Collaborate with other research groups to independently verify findings

This structured approach helps resolve discrepancies and build consensus on yaiY function, similar to how researchers address variability in other complex biological systems .

What statistical approaches are appropriate for analyzing yaiY structural dynamics data?

Analysis of structural dynamics data requires specialized statistical methods:

  • Time-series analysis for dynamics measurements

  • Markov state modeling for conformational transitions

  • Bayesian inference approaches for integrating multiple data types

  • Principal component analysis for identifying major modes of conformational change

  • Bootstrapping methods to assess confidence in structural models

These statistical frameworks help extract meaningful biological insights from complex structural data, particularly for flexible membrane proteins where dynamic behavior may be functionally important.

How can I integrate yaiY research data with broader systems biology approaches?

Integration of yaiY-focused research with systems-level studies can reveal broader functional contexts:

  • Network analysis incorporating protein-protein interaction data

  • Metabolic flux analysis to identify pathways affected by yaiY manipulation

  • Comparative genomics across bacterial species to infer evolutionary conservation

  • Multi-omics data integration (transcriptomics, proteomics, metabolomics)

  • Phenotypic profiling across diverse conditions

This integration positions yaiY research within the broader context of cellular function, potentially revealing unexpected connections to other biological processes.

What methodological validation steps are necessary when developing new assays for yaiY function?

Development of new functional assays for yaiY requires rigorous validation:

Validation ParameterMethodologyAcceptance Criteria
SpecificityTesting with closely related proteinsDifferential response between yaiY and controls
SensitivityConcentration-dependent measurementsDefined lower limit of detection
ReproducibilityReplicate testing across different conditionsCV < 15% for key measurements
Physiological relevanceCorrelation with in vivo phenotypesStatistically significant associations
RobustnessPerformance under varying conditionsStability across expected experimental variation

Proper validation ensures that new assays generate reliable data that genuinely reflects yaiY biology rather than experimental artifacts.

What emerging technologies hold promise for advancing yaiY research?

Several cutting-edge technologies are poised to accelerate membrane protein research including yaiY studies:

  • Advanced cryo-EM methods with improved resolution for membrane proteins

  • Native mass spectrometry for intact membrane protein complexes

  • Single-molecule fluorescence approaches for dynamic studies

  • Microfluidic platforms for high-throughput functional screening

  • CRISPR-based genetic screens for identifying genetic interactions

These technologies address long-standing challenges in membrane protein research and may provide unprecedented insights into yaiY structure and function.

How might yaiY research contribute to understanding broader principles of membrane protein biology?

Research on yaiY has potential to inform fundamental concepts in membrane biology:

  • Membrane protein folding and quality control mechanisms

  • Principles of protein-lipid interactions in bacterial membranes

  • Evolution of membrane protein families across bacterial species

  • Coordination between membrane proteins and cellular stress responses

  • General methodological advances applicable to other challenging membrane proteins

By addressing these broader questions through the specific lens of yaiY research, investigators contribute to both protein-specific knowledge and general principles in membrane biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.