Recombinant Inner membrane protein YbhL (ybhL)

Shipped with Ice Packs
In Stock

Description

Introduction to Inner Membrane Protein YbhL

YbhL is classified as an inner membrane protein found primarily in bacteria, particularly Escherichia coli. It consists of 234 amino acids and has been identified through genomic analysis as a membrane-associated protein with currently uncharacterized functions . The protein is encoded by the ybhL gene, which has associated UniProt identifiers P0AAC4 (for E. coli specific variants) and P0AAC5 (for more generic variants) . Interestingly, the ybhL gene has an upstream RNA element known as the "YbhL leader," which is a putative structured RNA element found specifically in alpha-proteobacteria . This suggests potential regulatory mechanisms controlling YbhL expression, though detailed functional studies are still needed to confirm this hypothesis.

The protein is part of a broader category of bacterial membrane proteins that play crucial roles in cellular processes including transport, signaling, and maintaining membrane integrity. Despite limited functional characterization, the commercial availability of recombinant YbhL allows researchers to investigate its properties and potential roles in bacterial physiology and possibly biotechnology applications.

The YbhL Leader RNA Element

Upstream of the ybhL gene, researchers have identified a structured RNA element known as the "YbhL leader" . This RNA structure may play a role in regulating the expression of the YbhL protein through mechanisms such as transcriptional or translational control. The YbhL leader is categorized as a cis-regulatory RNA element and has been assigned the Rfam identifier RF00520 . The presence of this regulatory element suggests sophisticated control over YbhL expression, potentially in response to specific environmental or cellular conditions.

Expression Systems

The recombinant production of YbhL primarily utilizes E. coli as the expression host, which is appropriate given that the protein naturally occurs in this organism . This approach helps ensure proper folding and membrane insertion, critical factors for maintaining the native structure of membrane proteins. Commercial suppliers offer recombinant YbhL expressed in E. coli with various fusion tags to facilitate purification and detection .

Fusion Tags and Purification Strategies

Most commercially available recombinant YbhL proteins are produced with N-terminal His-tags that facilitate purification through affinity chromatography . The recombinant protein typically includes the full-length sequence (amino acids 1-234), maintaining all structural elements of the native protein while adding the purification tag. The His-tagged version allows for efficient isolation from bacterial lysates using metal affinity chromatography, resulting in preparations with greater than 90% purity as determined by SDS-PAGE analysis .

Table 1: Specifications of Commercially Available Recombinant YbhL Proteins

ParameterSpecificationReference
SpeciesE. coli
Expression HostE. coli
TagHis (N-terminal)
Protein LengthFull Length (1-234 aa)
FormLyophilized powder
Purity>90% (SDS-PAGE)
UniProt IDP0AAC4/P0AAC5

Custom Production Options

Beyond commercially available preparations, custom production services offer tailored recombinant YbhL proteins with various specifications to meet research needs . These services provide options for different fusion tags (including His, FLAG, MBP, GST, trxA, Nus, Biotin, and GFP), expression systems (E. coli, yeast, mammalian, and insect cells), and purification protocols . This flexibility allows researchers to obtain recombinant YbhL with specific modifications suitable for particular experimental applications.

Reconstitution Protocols

For reconstitution of lyophilized YbhL protein, suppliers recommend briefly centrifuging the vial prior to opening to bring contents to the bottom . The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage of reconstituted protein, the addition of 5-50% glycerol (final concentration) is recommended, with many suppliers using 50% as their default concentration . The reconstituted protein should then be aliquoted for storage at -20°C or -80°C to minimize degradation from repeated freeze-thaw cycles.

Table 2: Storage and Handling Recommendations for Recombinant YbhL

ParameterRecommendationReference
Storage Temperature-20°C to -80°C
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution MediumDeionized sterile water
Reconstitution Concentration0.1-1.0 mg/mL
Recommended Additive5-50% glycerol (final concentration)
Working Storage4°C for up to one week

Comparison with YBHB and YBCL

While YbhL itself remains poorly characterized, there are related bacterial proteins—YBHB and YBCL—that have been studied in greater detail . YBHB and YBCL are homologues of mammalian RKIP (Raf kinase inhibitor protein, previously known as PEBP) and have been crystallized to determine their structures . These proteins are present in the cytoplasm (YBHB) and periplasm (YBCL) of E. coli, respectively . While direct functional relationships between YbhL and YBHB/YBCL have not been established in the available literature, their presence in the same organism suggests possible complementary or related functions.

Current Research Applications

Recombinant YbhL protein serves primarily as a research tool for investigating membrane protein properties, bacterial physiology, and potentially for antibody production. As an uncharacterized protein, it represents an opportunity for novel discoveries in bacterial membrane biology. Researchers can use the purified recombinant protein in:

  1. Structural studies to determine three-dimensional conformation

  2. Protein-protein interaction analyses to identify binding partners

  3. Functional assays to elucidate biological roles

  4. Antibody generation for localization and expression studies

Future Research Directions

Given the limited characterization of YbhL, several research directions could yield valuable insights:

  1. Detailed structural analysis using X-ray crystallography or cryo-electron microscopy

  2. Gene knockout or knockdown studies to determine phenotypic effects

  3. Protein-protein interaction screens to identify binding partners

  4. Investigation of the regulatory mechanisms involving the YbhL leader RNA

  5. Comparative analysis across bacterial species to understand evolutionary conservation

These approaches could help establish the biological significance of YbhL and potentially reveal new aspects of bacterial membrane biology or cellular signaling pathways.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format preference, please include this request in your order notes. We will accommodate your needs as much as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All protein shipments are delivered with standard blue ice packs. If dry ice packaging is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing of the protein is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the protein into smaller portions. Store these aliquots at -20°C/-80°C. Our standard protocol includes 50% glycerol. You can use this as a reference for your own preparations.
Shelf Life
The shelf life of our protein products depends on various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, liquid protein preparations have a shelf life of 6 months when stored at -20°C/-80°C. For lyophilized protein, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize developing the specified tag during production.
Synonyms
ybhL; c0868; Inner membrane protein YbhL
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-234
Protein Length
full length protein
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Target Names
ybhL
Target Protein Sequence
MDRFPRSDSIVQPRAGLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVMELLFTNRVFLI GLIIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFVVTA GMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIVFVG LTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR
Uniprot No.

Target Background

Database Links

KEGG: ecc:c0868

STRING: 199310.c0868

Protein Families
BI1 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YbhL and how is it related to other TMBIM family proteins?

YbhL is an inner membrane protein in E. coli belonging to the TMBIM family, which is evolutionarily conserved across almost the entire life kingdom. Based on structural homology with other TMBIM proteins, YbhL likely contains seven transmembrane helices arranged in a structure similar to that observed in the crystallized bacterial TMBIM protein BsYetJ from Bacillus subtilis. The TMBIM family proteins are present in humans, animals, plants, fungi, and prokaryotes, suggesting that TMBIM-mediated cellular protection is an ancient trait that emerged with single-cell organisms .

In humans, there are six TMBIM homologs (TMBIM1-6) that mediate calcium homeostasis and regulate cell death. YbhL shares core structural features with these proteins, particularly the conserved aspartic acid residues that form a pH-sensing mechanism regulating calcium flux .

What is the genomic organization of ybhL and what does it suggest about its regulation?

In E. coli (strain K12), the ybhL gene is physically clustered with ybhM (another TMBIM protein) in the genome. This clustering suggests that their expression might be co-regulated by a common promoter and transcription factor(s) . This genomic arrangement indicates potential functional cooperation between YbhL and YbhM, possibly forming a coordinated system for calcium homeostasis or stress response in bacteria. The regulation of these genes might be triggered under specific environmental conditions, similar to how eukaryotic TMBIM proteins respond to cellular stress.

What is the proposed function of YbhL in bacterial cells?

Based on functional studies of bacterial TMBIM proteins, YbhL likely mediates calcium uptake in E. coli. This is supported by studies showing that BsYetJ, another bacterial TMBIM protein, can uptake calcium when overexpressed in E. coli . The function appears to be pH-dependent, involving a mechanism where two conserved aspartic acid residues form a pH sensor that regulates calcium flux in response to environmental pH changes.

By analogy to eukaryotic TMBIM proteins that protect cells under stress conditions, bacterial TMBIM proteins including YbhL might be involved in cytoprotection through calcium homeostasis mechanisms, particularly under stress conditions such as heat and cold shock .

How does the structure of YbhL contribute to its function?

While the structure of YbhL itself has not been directly determined, insights can be gained from the crystal structure of BsYetJ, a bacterial TMBIM protein from Bacillus subtilis. Based on sequence homology, YbhL likely shares the following structural features:

  • Seven transmembrane helices with a novel fold consisting of two inversely assembled triple-helix-sandwich repeats surrounding a central helix

  • Conserved aspartic acid residues on TM6 and TM7 that form a pH-sensing mechanism

  • A flexible TM2 that undergoes significant conformational changes in response to pH

  • A pH-dependent gating mechanism where protonation of the conserved aspartic acid disrupts interactions with positively charged residues, leading to conformational changes that regulate calcium flux

This structure enables YbhL to sense environmental pH and regulate calcium transport accordingly, potentially contributing to bacterial stress responses.

What evolutionary insights can be gained from studying YbhL?

Studying YbhL provides valuable insights into the evolutionary origins of calcium regulation and cell death mechanisms. The conservation of TMBIM proteins from bacteria to humans suggests that:

  • Calcium homeostasis is an ancient and fundamental cellular process

  • The mechanisms for regulating calcium flux in response to pH emerged early in evolution

  • The cytoprotective functions of TMBIM proteins likely represent one of the earliest stress response systems

  • More complex regulatory mechanisms in eukaryotic TMBIM proteins evolved from these simpler bacterial precursors

The presence of three TMBIM proteins in E. coli (YbhL, YbhM, and YccA) may represent functional specialization that occurred during bacterial evolution .

What expression systems are most effective for recombinant YbhL production?

For recombinant YbhL production, consider these methodological approaches:

  • E. coli-based expression systems: As YbhL is native to E. coli, homologous expression can be advantageous. Consider specialized strains like C41(DE3), C43(DE3), or Lemo21(DE3) that are optimized for membrane protein expression.

  • Yeast expression systems: For higher yields, Pichia pastoris or Saccharomyces cerevisiae can be effective alternatives. When using yeast systems, it's crucial to control growth conditions tightly as research shows that the most rapid growth conditions are not necessarily optimal for membrane protein production .

  • Growth phase considerations: For yeast expression, harvest cells prior to glucose exhaustion, just before the diauxic shift, to maximize membrane protein yields. This critical timing significantly impacts production efficiency .

  • Bioreactor cultivation: Use high-performance bioreactors with tightly-defined growth regimes for consistent results, as membrane protein yields can vary substantially under different culture conditions .

  • Induction strategies: For E. coli systems, test various induction temperatures (16-30°C) and inducer concentrations, with lower temperatures often yielding better results for membrane proteins.

What purification strategies work best for YbhL as a membrane protein?

Purification of YbhL requires specialized approaches for membrane proteins:

  • Membrane isolation: Begin with careful isolation of membranes through differential centrifugation, followed by solubilization screening.

  • Detergent screening: Systematically test various detergents (e.g., DDM, LMNG, GDN) for optimal solubilization while maintaining protein stability and function. This is often the most critical step in membrane protein purification.

  • Affinity chromatography: Incorporate affinity tags (His, FLAG, etc.) for initial purification, but position them carefully to avoid interfering with protein folding or function.

  • Size exclusion chromatography: Essential for assessing protein homogeneity and removing aggregates. Monitor peak shape and retention volume to confirm monodispersity.

  • Stability assessment: Implement thermal stability assays (DSF/nanoDSF) throughout purification to monitor protein quality.

  • Alternative membrane mimetics: Consider reconstitution into nanodiscs, bicelles, or amphipols for improved stability, especially for functional studies.

The key challenge is maintaining YbhL's native conformation while removing it from its lipid environment, requiring careful optimization of each purification step.

How can I assess the functional activity of recombinant YbhL?

To evaluate YbhL functional activity, implement these methodological approaches:

  • Calcium uptake assays: Reconstitute purified YbhL into proteoliposomes and measure calcium uptake using fluorescent calcium indicators (e.g., Fura-2, Fluo-4) at varying pH values to assess pH-dependent activity.

  • pH-dependent conformational studies: Use spectroscopic techniques (circular dichroism, fluorescence spectroscopy) to monitor pH-induced structural changes, correlating them with functional outcomes.

  • Complementation studies: Express recombinant YbhL in ybhL-knockout E. coli strains and assess restoration of phenotypes under various stress conditions.

  • Binding assays: Use isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) to quantify calcium binding parameters and pH-dependency.

  • Electrophysiology: For direct measurement of ion transport, consider reconstituting YbhL in planar lipid bilayers and record channel activity under varying pH and calcium concentrations.

  • In vivo calcium imaging: Express genetically-encoded calcium indicators in E. coli to monitor calcium dynamics in wild-type versus ΔybhL strains under different conditions.

These complementary approaches provide a comprehensive assessment of YbhL function, critical for understanding its role in bacterial calcium homeostasis.

What are the optimal growth conditions for maximizing recombinant YbhL yield?

Based on membrane protein production research, consider these methodological strategies:

  • Growth rate control: Contrary to conventional approaches, the most rapid growth conditions are not optimal for membrane protein production. Moderate growth rates often yield better results for membrane proteins like YbhL .

  • Harvest timing: Critical for maximum yield, harvest cells before glucose exhaustion and the diauxic shift. This timing significantly impacts membrane protein yields more than many other factors .

  • Temperature optimization: Test expression at reduced temperatures (16-22°C) which often improves membrane protein folding and reduces inclusion body formation.

  • Media composition: Supplement with components that enhance membrane protein production (e.g., glycerol as membrane stabilizer, specific metal ions if required for protein function).

  • Induction strategy: Optimize inducer concentration and induction duration through systematic screening. For toxic membrane proteins, consider leaky expression systems or very low inducer concentrations.

  • Oxygen levels: Control dissolved oxygen levels precisely in bioreactors, as oxygen limitation can significantly impact membrane protein expression.

  • pH control: Maintain optimal pH throughout cultivation, particularly important for pH-sensitive proteins like YbhL that undergo pH-dependent conformational changes.

These parameters should be systematically optimized and precisely controlled using bioreactors rather than shake flasks for reproducible results .

What structural analysis techniques are most suitable for YbhL characterization?

For comprehensive structural characterization of YbhL, employ these methodological approaches:

  • X-ray crystallography: Though challenging for membrane proteins, this remains the gold standard for high-resolution structures. Key considerations include:

    • Extensive detergent and crystallization condition screening

    • Use of lipidic cubic phase (LCP) crystallization

    • Addition of antibody fragments or nanobodies to enhance crystallization

    • Testing crystallization at different pH values to capture distinct conformational states

  • Cryo-electron microscopy: Increasingly powerful for membrane proteins:

    • Consider detergent, amphipol, or nanodisc reconstitution

    • Implement computational particle classification to deal with conformational heterogeneity

    • Use focused refinement for flexible regions

  • NMR spectroscopy: For dynamics and ligand binding:

    • Solution NMR for flexible regions and ligand interactions

    • Solid-state NMR for transmembrane domain structure in native-like environments

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Excellent for mapping conformational changes:

    • Compare exchange patterns at different pH values to identify pH-sensitive regions

    • Map calcium-binding induced conformational changes

  • Molecular dynamics simulations: To understand dynamics and ion permeation:

    • Simulate YbhL in explicit membrane environments

    • Model pH-dependent conformational changes through protonation state alterations

    • Predict ion permeation pathways and energy barriers

Combining these complementary techniques provides a comprehensive structural understanding beyond what any single method can achieve.

How do I interpret contradictory data about YbhL function across different experimental conditions?

When faced with contradictory results regarding YbhL function, implement this systematic analytical approach:

  • pH consideration: Since YbhL likely functions as a pH-dependent calcium transporter, different pH conditions may reveal different functional states. Create a systematic matrix of experimental conditions vs. functional outcomes, paying special attention to pH values .

  • Experimental system comparison: Different membrane environments (native membranes, proteoliposomes, nanodiscs) may yield different results due to lipid composition effects on protein conformation and function.

  • Protein conformation assessment: YbhL likely exists in at least two conformational states (open/closed) depending on pH, similar to BsYetJ which shows different conformations at pH 6, 7, and 8 . Determine which conformation predominates in your experimental conditions.

  • Functional assay limitations: Different assays measure different aspects of function—direct calcium flux, binding, or downstream effects. Create a table correlating assay type with specific functional parameters measured.

  • Genetic background effects: When using complementation studies, consider that other genetic differences between strains may influence YbhL function through indirect interactions.

  • Statistical robustness analysis: Implement rigorous statistical approaches appropriate for non-normally distributed data often encountered with membrane proteins, and critically evaluate whether apparent contradictions exceed statistical variance.

This structured approach allows for reconciliation of seemingly contradictory results by understanding the context-dependency of YbhL function.

How can I distinguish between direct and indirect effects when studying YbhL function in vivo?

To differentiate direct from indirect effects in YbhL functional studies:

  • Complementation controls:

    • Use both wild-type YbhL and non-functional mutants (e.g., mutations in conserved aspartic acids) for complementation

    • Implement titrated expression systems to match physiological expression levels

    • Use both homologous (E. coli) and heterologous (non-E. coli) expression for comparison

  • Immediate vs. delayed responses:

    • Develop time-course experiments with high temporal resolution

    • Use rapid induction or inhibition systems to capture immediate effects

    • Monitor calcium levels with high-speed calcium imaging to identify primary responses

  • Correlation vs. causation analysis:

    • Implement Granger causality testing for time-series data

    • Develop mathematical models incorporating known cellular pathways

    • Use conditional probability approaches to assess dependency relationships

  • Direct interaction verification:

    • Use in vitro reconstituted systems with purified components

    • Implement FRET-based proximity assays for real-time interaction monitoring

    • Employ crosslinking approaches with mass spectrometry for direct interactor identification

  • Genetic interaction mapping:

    • Create systematic double-knockout/knockdown combinations

    • Implement synthetic genetic array analysis if applicable

    • Use epistasis analysis to establish pathway relationships

This multi-faceted approach provides robust evidence for distinguishing direct YbhL functions from secondary cellular responses.

What are the most reliable control experiments for YbhL functional studies?

Implement these critical controls for robust YbhL functional studies:

  • Genetic controls:

    • Clean ybhL deletion strain

    • Complementation with wild-type ybhL under native promoter

    • Complementation with catalytically inactive mutant (e.g., D171A equivalent based on BsYetJ structure)

    • Empty vector control

    • ybhM single deletion and ybhL/ybhM double deletion to assess functional redundancy

  • Expression controls:

    • Quantitative Western blotting to ensure consistent expression levels

    • mRNA quantification to rule out transcriptional effects

    • Membrane localization verification using fractionation or microscopy

    • Protein stability assessment under experimental conditions

  • Functional controls:

    • Calcium ionophore (positive control for calcium flux)

    • Known calcium channel inhibitors as reference points

    • pH controls (buffer-only) to distinguish protein-mediated from passive effects

    • Alternative ion measurements to confirm specificity

  • Environmental controls:

    • Precise pH control and measurement

    • Temperature standardization

    • Growth phase standardization (harvest before diauxic shift)

    • Media composition consistency

  • Data analysis controls:

    • Randomization and blinding where applicable

    • Technical and biological replicates with appropriate statistics

    • Multiple data visualization approaches to avoid bias

    • Independent verification using complementary techniques

These comprehensive controls ensure that observed effects are specifically attributable to YbhL function rather than experimental artifacts or indirect effects.

How should I analyze YbhL conformational changes in response to pH variation?

To systematically analyze pH-dependent conformational changes in YbhL:

  • Experimental design strategy:

    • Create a pH titration series with fine increments (0.2-0.5 pH units) from pH 5.5-8.5

    • Implement time-resolved measurements to capture transition kinetics

    • Include proper buffering controls to maintain pH during measurements

    • Ensure protein stability across the pH range being tested

  • Structural analysis techniques:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map regions undergoing conformational changes

    • Intrinsic fluorescence spectroscopy monitoring tryptophan environment changes

    • Circular dichroism to detect secondary structure alterations

    • Site-directed spin labeling with EPR for distance measurements between specific residues

  • Computational analysis:

    • Molecular dynamics simulations at different protonation states

    • Principal component analysis to identify major conformational changes

    • Energy landscape modeling to identify stable conformational states

    • Markov state modeling for transition probabilities between conformations

  • Data integration framework:

    • Create conformational state maps as a function of pH

    • Correlate structural changes with functional outcomes in transport assays

    • Develop mathematical models of the conformational transition

    • Compare with known pH-dependent conformational changes in BsYetJ

This comprehensive approach allows for detailed characterization of how YbhL transitions between conformational states in response to pH changes, providing insights into its regulatory mechanism.

What bioinformatic approaches can identify functional residues in YbhL?

Implement these computational methods to identify key functional residues in YbhL:

  • Evolutionary analysis:

    • Multiple sequence alignment of TMBIM family proteins across species

    • Calculation of conservation scores using methods like ConSurf

    • Evolutionary trace analysis to identify functionally important residues

    • Coevolution analysis to identify co-varying residue networks

  • Structure-based predictions:

    • Homology modeling based on BsYetJ crystal structure

    • Molecular dynamics simulations to identify stable interaction networks

    • Binding site prediction for calcium and other potential ligands

    • Electrostatic surface mapping to identify potential ion pathways

  • Machine learning integration:

    • Feature-based prediction of functional sites using trained neural networks

    • Gradient boosting methods incorporating both sequence and structural features

    • Automated pattern recognition for identifying functional motifs

    • Transfer learning from well-characterized membrane transporters

  • Functional annotation mapping:

    • Gene Ontology term enrichment analysis

    • Pathway association prediction

    • Protein-protein interaction network analysis

    • Literature mining for functional associations

  • Experimental validation design:

    • Prioritization of residues for site-directed mutagenesis

    • Design of minimal functional constructs based on computational predictions

    • Development of specific functional assays targeting predicted mechanisms

    • Rational design of protein variants with altered pH sensitivity

This multi-layered bioinformatic approach provides a comprehensive framework for identifying and prioritizing functionally important residues for experimental validation.

What is the molecular mechanism of pH sensing in YbhL?

Based on structural studies of the related bacterial TMBIM protein BsYetJ, the pH-sensing mechanism in YbhL likely involves these molecular components:

  • Conserved aspartic acid residues: Two highly conserved aspartic acids (equivalent to Asp171 on TM6 and Asp195 on TM7 in BsYetJ) form an H-bond that serves as the core pH sensor . These residues are conserved across the TMBIM family, including YbhL.

  • pH-dependent conformational switch: At high pH (approximately 8.0), the carboxylate group of the TM6 aspartic acid remains deprotonated and negatively charged, forming a hydrogen-bonded salt bridge with a positively charged residue (likely an arginine) from TM2. This interaction maintains YbhL in a closed conformation .

  • Protonation-induced structural change: At lower pH (approximately 6.0), protonation of the TM6 aspartic acid disrupts its interaction with the TM2 residue, triggering a substantial conformational change where TM2 moves by as much as 14 Å, opening the structure to allow calcium flux .

  • Structural equilibrium: At intermediate pH (approximately 7.0), YbhL likely exists in an equilibrium between open and closed conformations, allowing for graded responses to pH changes .

  • Calcium coordination: The open conformation creates a pathway for calcium ions, potentially coordinated by negative charges from multiple residues forming an ion conduction pathway.

This pH-sensing mechanism allows YbhL to respond to environmental pH changes by modulating its calcium transport activity, potentially contributing to bacterial stress responses and homeostasis.

How does YbhL interact with other membrane proteins in the bacterial calcium homeostasis network?

To understand YbhL's role in the bacterial calcium network, consider these interaction mechanisms:

  • Genomic context-based interactions: YbhL and YbhM genes are physically clustered in the E. coli genome, suggesting functional cooperation . This genomic arrangement indicates they may form a coordinated system, potentially through:

    • Direct protein-protein interactions

    • Functional redundancy or complementarity

    • Co-regulation by common transcription factors

  • Calcium transport system integration: YbhL likely functions within a broader calcium homeostasis network including:

    • Primary calcium transporters (Ca²⁺-ATPases)

    • Secondary transporters (Ca²⁺/H⁺ and Ca²⁺/Na⁺ exchangers)

    • Calcium channels and other calcium-binding proteins

    • pH homeostasis systems that indirectly affect YbhL function

  • Stress response pathway connections: By analogy to eukaryotic TMBIM proteins, YbhL may interact with:

    • General stress response regulators

    • Specific stress-sensing proteins

    • Redox-sensitive components

    • Energy metabolism proteins during stress conditions

  • Methodological approach to mapping interactions:

    • Membrane-specific interactome analysis using in vivo crosslinking

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Co-immunoprecipitation with quantitative proteomics

    • Genetic interaction screens (synthetic lethality/sickness)

    • Fluorescence-based protein complementation assays

Understanding these interactions will provide critical insights into how YbhL's calcium transport function is integrated into broader bacterial physiological processes and stress response mechanisms.

What role does YbhL play in bacterial stress response mechanisms?

To investigate YbhL's function in bacterial stress response:

  • Stress condition profiling:

    • Systematic analysis of ΔybhL strain survival under various stressors:

      • Acid/alkaline stress (particularly relevant given YbhL's pH sensitivity)

      • Oxidative stress (H₂O₂, paraquat)

      • Membrane stress (detergents, antimicrobial peptides)

      • Temperature extremes

      • Nutrient limitation

    • Quantitative growth curves, survival rates, and recovery kinetics

  • Calcium dynamics during stress:

    • Real-time measurement of intracellular calcium using genetically-encoded calcium indicators

    • Comparison between wild-type and ΔybhL strains during stress exposure

    • Correlation between calcium fluctuations and stress adaptation outcomes

  • Transcriptional response analysis:

    • RNA-seq comparing wild-type and ΔybhL strains under normal and stress conditions

    • ChIP-seq to identify stress-responsive transcription factors that regulate ybhL

    • Quantitative RT-PCR validating key stress-responsive genes affected by ybhL deletion

  • Membrane integrity assessment:

    • Membrane potential measurements during stress

    • Lipid composition analysis under stress conditions

    • Permeability assays with fluorescent probes

  • Connection to established stress pathways:

    • Genetic epistasis analysis with known stress response genes

    • Double mutant analysis with stress response regulators

    • Phosphorylation state of stress response proteins

This comprehensive approach can establish YbhL's specific contributions to bacterial stress tolerance, potentially revealing novel stress adaptation mechanisms mediated by calcium homeostasis.

How do post-translational modifications affect YbhL function?

While bacterial proteins generally undergo fewer post-translational modifications (PTMs) than eukaryotic proteins, several modifications may regulate YbhL function:

  • Phosphorylation:

    • Identification strategy: Phosphoproteomics comparing standard and stress conditions

    • Potential sites: Serine, threonine, or tyrosine residues in cytoplasmic loops or termini

    • Functional impact: May alter conformation, pH sensitivity, or protein-protein interactions

    • Methodological approach: Site-directed mutagenesis of potential phosphorylation sites to phosphomimetic (Asp/Glu) or non-phosphorylatable (Ala) residues

  • Redox modifications:

    • Target residues: Cysteine thiols undergoing oxidation, S-glutathionylation, or disulfide formation

    • Physiological relevance: May link oxidative stress to calcium homeostasis

    • Detection methods: Redox proteomics with differential alkylation

    • Functional testing: Compare activity under reducing vs. oxidizing conditions

  • N-terminal processing:

    • Possibility: Removal of N-terminal formyl-methionine or signal sequences

    • Impact: May affect protein localization or activation

    • Analysis approach: N-terminal sequencing and mass spectrometry

  • Experimental strategy:

    • Comparative PTM profiling under different stress conditions

    • Mass spectrometry identification of modifications

    • Creation of YbhL variants mimicking or preventing identified PTMs

    • Functional assays correlating modifications with calcium transport activity

    • Identification of enzymes responsible for reversible modifications

Understanding PTMs would provide insights into how YbhL activity is dynamically regulated in response to changing cellular conditions, potentially revealing new dimensions of bacterial signaling networks.

How can structural modeling of YbhL guide the development of specific functional probes?

Using structural insights to develop YbhL-specific tools:

  • Homology model development:

    • Base the model on the BsYetJ crystal structure, which exists in multiple conformational states (pH 6, 7, and 8)

    • Refine the model using molecular dynamics simulations in explicit membrane

    • Validate critical regions through targeted mutagenesis and functional assays

    • Generate models of both open and closed conformations

  • Calcium permeation pathway mapping:

    • Identify constriction points and calcium coordination sites

    • Calculate electrostatic surfaces to predict ion pathways

    • Design mutations that alter calcium selectivity or conductance

    • Develop specific calcium flux assays based on these predictions

  • Conformation-specific probe design:

    • Identify residues accessible only in specific conformational states

    • Design chemical probes that selectively label these residues

    • Develop antibodies or nanobodies recognizing specific conformations

    • Create FRET-based sensors monitoring conformational transitions

  • Structure-guided inhibitor development:

    • Virtual screening for compounds binding to specific sites

    • Fragment-based design targeting the pH sensor region

    • Allosteric modulator design targeting conformational transitions

    • Photoaffinity labels for mapping binding sites

  • Application in functional studies:

    • Use conformation-specific probes to quantify YbhL conformational states in vivo

    • Apply inhibitors as chemical biology tools to acutely modulate YbhL function

    • Implement engineered YbhL variants as calcium flux reporters

    • Develop biosensors linking YbhL conformational changes to reporter outputs

This structure-guided approach provides powerful tools for dissecting YbhL function with high temporal and spatial resolution, advancing our understanding of bacterial calcium homeostasis.

What are the most promising future research directions for YbhL studies?

Future YbhL research should focus on these high-impact areas:

  • Structural biology advancements:

    • Determination of YbhL structure in multiple conformational states

    • Time-resolved structural studies capturing conformational transitions

    • Structural basis of calcium selectivity and conductance

  • Physiological role clarification:

    • Comprehensive phenotypic characterization of ybhL knockout under diverse conditions

    • Calcium signaling networks in bacteria and YbhL's position within them

    • Connection between calcium homeostasis and bacterial stress responses

  • Evolutionary perspectives:

    • Comparative analysis of TMBIM proteins across bacterial species

    • Reconstruction of evolutionary trajectory from bacterial to eukaryotic TMBIM proteins

    • Functional divergence of YbhL, YbhM, and YccA in E. coli

  • Technological innovations:

    • Development of YbhL-specific activity modulators

    • Real-time calcium imaging in bacterial systems

    • High-throughput functional assays for structure-function studies

  • Translational applications:

    • Exploration of YbhL as a potential antimicrobial target

    • Engineering YbhL as a calcium transport module for synthetic biology

    • Application of YbhL structural insights to understanding human TMBIM proteins in disease

These research directions will advance our fundamental understanding of bacterial calcium homeostasis while potentially yielding applications in biotechnology and medicine.

How can insights from YbhL research contribute to understanding human TMBIM proteins?

YbhL research provides valuable insights for human TMBIM proteins through:

  • Structural framework foundation:

    • The simpler bacterial TMBIM proteins like YbhL serve as structural templates for understanding more complex human homologs

    • The pH-sensing mechanism identified in bacterial TMBIM proteins is likely conserved in human TMBIM1-6

    • The calcium transport pathway elucidated in bacterial systems can inform human TMBIM calcium flux mechanisms

  • Evolutionary perspective:

    • Tracking functional adaptations from bacterial to human TMBIM proteins reveals core conserved functions

    • Understanding how additional domains in human TMBIM proteins modify the ancestral function

    • Identifying which aspects of calcium regulation preceded cell death regulation in evolution

  • Mechanistic insights transfer:

    • pH-dependent conformational changes characterized in YbhL can guide studies of human TMBIM proteins

    • The role of conserved aspartic acid residues in forming a pH sensor applies across the family

    • Calcium transport mechanisms elucidated in bacterial systems apply to human counterparts

  • Methodological advances:

    • Expression and purification strategies optimized for YbhL can be adapted for human TMBIM proteins

    • Functional assays developed for bacterial systems can be modified for human proteins

    • Computational models validated with bacterial proteins provide templates for human protein modeling

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.