Recombinant Inner membrane protein yccF (yccF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your required tag type at the time of ordering to prioritize its implementation.
Synonyms
yccF; SF0963; S1029; Inner membrane protein YccF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Shigella flexneri
Target Names
yccF
Target Protein Sequence
MRTVLNILNFVLGGFATTLGWLLATLVSIVLIFTLPLTRSCWEITKLSLVPYGNEAIHVD ELNPAGKNVLLNTGGTVLNIFWLIFFGWWLCLMHIATGIAQCISIIGIPVGIANFKIAAI ALWPVGRRVVSVETAQAAREANARRRFE
Uniprot No.

Target Background

Database Links

KEGG: sfl:SF0963

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Inner membrane protein yccF?

Inner membrane protein yccF is a DUF307 family membrane protein found in bacteria such as Escherichia coli strain K12. The protein has a molecular weight of approximately 16,275 Da and contains three predicted transmembrane domains . Based on bioinformatic analyses, yccF is localized to the inner membrane of bacterial cells, though its specific physiological function remains an area of active investigation.

The protein contains both N-terminal and potentially C-terminal tags when produced as a recombinant protein, with the specific tag types dependent on protein stability factors . Understanding the structure-function relationship of yccF requires careful examination of both its transmembrane domains and any extracellular or cytoplasmic regions that may participate in cellular processes.

How can I verify the subcellular localization of recombinant yccF protein?

Verification of subcellular localization for membrane proteins like yccF requires a multi-method approach:

  • Indirect immunofluorescence (IFA): This technique can be used to visualize the distribution of the protein within cellular compartments. For example, in studies of other membrane proteins, IFA has confirmed plasma membrane localization by showing peripheral distribution patterns .

  • Subcellular fractionation: Separate membrane, cytoplasmic, and nuclear fractions through differential centrifugation, followed by Western blot analysis to detect the protein in specific fractions.

  • Biotinylation assays: Surface biotinylation can be used to label membrane proteins, followed by isolation of biotinylated proteins and detection of your target protein. This approach can confirm whether the protein localizes to the plasma membrane, as demonstrated with other membrane proteins .

  • Co-localization studies: Use reference proteins with known localization patterns (such as actin for cytoskeleton or other established membrane markers) to confirm the distribution pattern of yccF .

What expression systems are suitable for producing recombinant yccF protein?

Several expression systems can be used for recombinant yccF production, each with distinct advantages:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid expressionMay form inclusion bodies requiring refolding, limited post-translational modifications
YeastEukaryotic processing, higher-order foldingLonger production time, potential hypermannosylation
BaculovirusSuperior folding for complex proteins, post-translational modificationsMore complex system, higher cost, longer production time
Mammalian cellMost native-like folding and modificationsHighest cost, lowest yield, technical complexity

For bacterial membrane proteins like yccF, E. coli expression systems are frequently used, though protein may form inclusion bodies requiring optimization of solubilization and refolding protocols . When expressing membrane proteins, consider including solubilization tags or fusion partners that can enhance membrane integration and proper folding.

How should I design experiments to study the functional role of yccF in bacterial cells?

A robust experimental design for studying yccF function should include:

  • Gene knockout/knockdown studies: Create yccF deletion mutants or use RNA interference to reduce expression. Monitor phenotypic changes in growth, metabolism, membrane integrity, or stress response to identify potential functions. This approach has proven effective for other membrane proteins, such as Ycf 1 in N. bombycis, where RNAi knockdown significantly inhibited proliferation .

  • Complementation assays: Re-introduce the wild-type gene to knockout strains to confirm that observed phenotypes are specifically due to the absence of yccF.

  • Site-directed mutagenesis: Create point mutations in key domains to identify critical residues for function.

  • Interactome analysis: Use pull-down assays, co-immunoprecipitation, or yeast two-hybrid screens to identify protein interaction partners that may indicate functional pathways.

  • Gene expression analysis: Perform RNA-seq under various conditions to identify when yccF is up- or down-regulated, providing clues to its function.

A properly controlled experiment should include:

  • Appropriate positive and negative controls

  • Multiple biological and technical replicates

  • Quantitative measurements with statistical analysis

  • Validation using complementary methodologies

What are the optimal conditions for solubilizing and purifying recombinant yccF protein?

Membrane protein solubilization and purification requires careful optimization:

  • Detergent screening: Test multiple detergents at various concentrations to identify optimal solubilization conditions:

    • Non-ionic detergents (DDM, OG, Triton X-100) for milder extraction

    • Zwitterionic detergents (CHAPSO, LDAO) for intermediate strength

    • Ionic detergents (SDS) for complete but potentially denaturing solubilization

  • Purification strategy:

    • Utilize affinity chromatography based on the specific tags incorporated into your construct

    • Implement size exclusion chromatography as a polishing step to separate aggregates

    • Consider ion exchange chromatography to remove contaminants

  • Buffer optimization:

    • Screen various pH conditions (typically pH 6.5-8.0)

    • Test different ionic strengths and salt types

    • Include stabilizing agents such as glycerol (10-20%)

    • Add specific lipids that may enhance protein stability

  • Quality control assessments:

    • SDS-PAGE for purity evaluation (aim for ≥85% purity)

    • Circular dichroism to assess secondary structure

    • Dynamic light scattering to detect aggregation

Based on similar membrane protein studies, starting with a buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% glycerol, and 0.1% DDM would be a reasonable initial condition for yccF.

How can I assess the biological activity of purified recombinant yccF?

Assessing biological activity of recombinant membrane proteins like yccF requires multiple approaches:

  • Structural integrity verification:

    • Circular dichroism spectroscopy to confirm secondary structure elements

    • Limited proteolysis to assess native folding

    • Thermal shift assays to determine protein stability

  • Functional assays (depending on predicted function):

    • If a transporter: liposome reconstitution and transport assays

    • If involved in signaling: interaction studies with putative signaling partners

    • If enzymatic: specific enzymatic activity measurements

  • Binding studies:

    • Surface plasmon resonance to measure interactions with potential ligands

    • Isothermal titration calorimetry for thermodynamic binding parameters

    • Fluorescence-based binding assays with labeled ligands

  • In vitro reconstitution:

    • Incorporation into artificial membrane systems to study native-like behavior

    • Channel activity measurement if appropriate (patch clamp)

  • Complementation experiments:

    • Introduction of purified protein into yccF-deficient cells to restore function

    • Comparison with wild-type cells to confirm complete restoration of activity

What approaches can be used to study potential post-translational modifications of yccF?

Investigating post-translational modifications (PTMs) of membrane proteins requires specialized techniques:

  • Mass spectrometry-based approaches:

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) for comprehensive PTM identification

    • Targeted multiple reaction monitoring (MRM) for quantifying specific modifications

    • Use of enrichment strategies (e.g., titanium dioxide for phosphopeptides, lectin affinity for glycopeptides)

  • Site-specific modification analysis:

    • Use of phosphorylation-specific antibodies for Western blotting

    • Enzymatic deglycosylation followed by gel shift analysis

    • Metabolic labeling with modification-specific precursors

  • Functional impact assessment:

    • Site-directed mutagenesis of predicted modification sites

    • Comparison of wild-type and mutant protein properties

    • Correlation of modification states with functional outcomes

For bacterial membrane proteins like yccF, phosphorylation is a commonly observed PTM that may regulate function. Similar membrane proteins have been reported to contain multiple phosphorylation sites (e.g., Ycf 1 contains thirty-six phosphorylation sites) and potential glycosylation sites that influence their function .

How can I resolve discrepancies between predicted and observed molecular weights of recombinant yccF?

Discrepancies between predicted and observed molecular weights are common with membrane proteins and can be methodically addressed:

  • Potential causes:

    • Post-translational modifications: phosphorylation, glycosylation

    • Incomplete denaturation in SDS-PAGE

    • Anomalous migration due to hydrophobicity

    • Presence of bound detergent molecules

    • Presence of fusion tags or uncleaved signal peptides

  • Analytical approaches:

    • Mass spectrometry for accurate mass determination

    • Different gel systems (Tris-glycine vs. Tris-tricine)

    • Varying sample preparation conditions (boiling time, detergent concentration)

    • Enzymatic treatments to remove specific modifications

  • Validation methods:

    • Western blotting with domain-specific antibodies

    • Limited proteolysis followed by mass spectrometry

    • N-terminal sequencing to confirm processing

Studies of other membrane proteins have shown that observed molecular weights can be significantly larger than predicted. For example, a protein with predicted size of 35 kDa might appear as a 50 kDa band due to post-translational modifications , similar to what was observed with the Ycf 1 membrane protein in N. bombycis.

What statistical approaches are most appropriate for analyzing data from yccF functional studies?

Statistical analysis of membrane protein functional studies requires careful consideration:

When designing experiments, ensure adequate sample size through power analysis, with consideration of biological replicates (different protein preparations) versus technical replicates (repeated measurements) .

How does yccF compare structurally and functionally with other bacterial inner membrane proteins?

Comparative analysis of yccF with other bacterial inner membrane proteins:

  • Structural comparisons:

    • Sequence alignment with homologous proteins to identify conserved domains

    • Secondary structure prediction comparison with other DUF307 family proteins

    • Transmembrane topology analysis using prediction algorithms

    • Structural modeling based on homologous proteins with known structures

  • Functional relationships:

    • Gene neighborhood analysis to identify functionally related genes

    • Co-expression network analysis to find genes with similar expression patterns

    • Phylogenetic profiling to identify co-evolutionary relationships

    • Comparison with characterized members of the DUF307 family

  • Evolutionary considerations:

    • Conservation analysis across bacterial species

    • Identification of selective pressure on specific domains

    • Horizontal gene transfer assessment

Many bacterial inner membrane proteins serve as transporters, channels, or signal transducers. The DUF307 family to which yccF belongs contains proteins with unknown function, but structural analysis may reveal similarities to better-characterized membrane protein families that could provide functional insights.

What role might yccF play in bacterial stress response and antimicrobial resistance?

Investigating the potential role of yccF in stress response and antimicrobial resistance:

  • Experimental approaches:

    • Gene expression analysis under various stress conditions (oxidative, pH, osmotic)

    • Sensitivity testing of yccF knockout strains to antibiotics and stressors

    • Complementation studies to confirm phenotype-genotype relationships

    • Overexpression studies to assess potential protective effects

  • Mechanistic investigations:

    • Membrane integrity assessment using fluorescent dyes

    • Membrane potential measurements in wild-type versus mutant strains

    • Efflux activity measurements if relevant

    • Lipidomic analysis to detect membrane composition changes

  • Clinical relevance assessment:

    • Comparative genomics of resistant versus susceptible clinical isolates

    • Expression analysis in biofilm versus planktonic states

    • Correlation of expression levels with minimum inhibitory concentrations

Membrane proteins often contribute to bacterial survival under stress conditions by maintaining membrane integrity, facilitating efflux of toxic compounds, or participating in signaling cascades that activate stress response pathways. Understanding yccF's role could potentially identify novel targets for antimicrobial development.

How can advanced imaging techniques enhance our understanding of yccF localization and dynamics?

Advanced imaging approaches for membrane protein research:

  • Super-resolution microscopy techniques:

    • Stimulated emission depletion (STED) microscopy

    • Photoactivated localization microscopy (PALM)

    • Stochastic optical reconstruction microscopy (STORM)

    • These techniques overcome the diffraction limit of conventional microscopy to visualize membrane protein distribution at nanoscale resolution

  • Live-cell imaging approaches:

    • Fluorescence recovery after photobleaching (FRAP) to measure lateral mobility

    • Fluorescence correlation spectroscopy (FCS) for diffusion dynamics

    • Single-particle tracking to follow individual protein molecules

    • These methods provide insights into protein dynamics in real-time

  • Correlative light and electron microscopy (CLEM):

    • Combines fluorescence localization with ultrastructural context

    • Provides nanometer-scale resolution of protein localization

    • Particularly valuable for membrane proteins at specialized membrane domains

  • Förster resonance energy transfer (FRET):

    • Measures protein-protein interactions in living cells

    • Can detect conformational changes in response to stimuli

    • Provides spatial information about protein complexes

Similar to studies of other membrane proteins, these advanced imaging techniques could reveal the precise subcellular distribution of yccF, its association with specific membrane microdomains, and dynamic responses to environmental changes or stress conditions .

How can recombinant yccF be utilized in drug discovery and development research?

Applications of recombinant yccF in drug discovery platforms:

  • Target-based screening approaches:

    • Development of binding assays to identify small molecule interactors

    • Structure-based virtual screening once structural information is available

    • Fragment-based drug discovery to identify chemical starting points

  • Functional assays for compound screening:

    • Development of activity-based assays depending on identified function

    • Phenotypic screening using yccF-expressing or knockout cell lines

    • Membrane disruption or integrity assays if appropriate

  • Structural studies for rational drug design:

    • X-ray crystallography or cryo-EM studies with purified protein

    • NMR studies of specific domains or the full-length protein

    • In silico modeling and docking studies to predict binding sites

  • Validation approaches:

    • Site-directed mutagenesis to confirm binding sites

    • Isothermal titration calorimetry or surface plasmon resonance to measure binding affinities

    • Cellular assays to confirm compound efficacy and specificity

Membrane proteins like yccF represent important potential drug targets, as approximately 60% of current therapeutic drugs target membrane proteins. Similar to other bacterial membrane proteins, yccF could potentially serve as a target for novel antimicrobials if its function is found to be essential .

What are the most promising approaches for determining the high-resolution structure of yccF?

Strategies for structural determination of membrane proteins like yccF:

  • X-ray crystallography approaches:

    • Lipidic cubic phase crystallization

    • Detergent screening for optimal crystal formation

    • Use of antibody fragments or nanobodies to stabilize specific conformations

    • Fusion with crystallization chaperones (e.g., T4 lysozyme)

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for larger membrane proteins/complexes

    • Electron crystallography of 2D crystals

    • Advantages include lower protein quantity requirements and visualization of multiple conformational states

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Solution NMR for smaller domains or fragments

    • Solid-state NMR for full-length membrane proteins

    • Provides dynamic information not accessible by static methods

  • Hybrid approaches:

    • Integration of low-resolution electron microscopy with high-resolution X-ray or NMR data

    • Computational modeling informed by experimental constraints

    • Cross-linking mass spectrometry to provide distance constraints

Each approach has specific advantages and challenges. For bacterial membrane proteins like yccF with multiple transmembrane domains, crystallization in lipidic cubic phase followed by X-ray diffraction or single-particle cryo-EM analysis would be promising initial approaches.

How can systems biology approaches integrate yccF research with broader cellular pathways?

Systems biology integration strategies:

  • Multi-omics data integration:

    • Correlation of transcriptomics, proteomics, and metabolomics data

    • Network analysis to position yccF within cellular interaction networks

    • Identification of condition-specific regulatory mechanisms

  • Mathematical modeling approaches:

    • Kinetic models of pathways involving yccF

    • Flux balance analysis to understand metabolic impact

    • Agent-based modeling for cellular response simulations

  • Genome-scale studies:

    • Synthetic genetic array analysis to identify genetic interactions

    • CRISPRi screening for functional partners

    • Transposon sequencing to identify conditional essentiality

  • Integrative visualization and analysis tools:

    • Pathway mapping and enrichment analysis

    • Network visualization and centrality analysis

    • Multi-scale modeling from molecular to cellular levels

These approaches can help position yccF within its biological context, identifying its role in cellular processes and potential intervention points for therapeutic development. Similar integrative approaches have been valuable for understanding the roles of other membrane proteins in cellular physiology .

How can I improve solubility and stability of recombinant yccF during purification?

Strategies to enhance membrane protein stability and solubility:

  • Expression optimization:

    • Lower expression temperature (16-20°C) to slow production and improve folding

    • Use of specialized strains with enhanced membrane protein expression capacity

    • Codon optimization for the expression host

    • Controlled expression systems to prevent toxic accumulation

  • Solubilization improvements:

    • Screening of diverse detergent classes and concentrations

    • Use of detergent mixtures or novel solubilization agents (SMALPs, amphipols)

    • Addition of specific lipids that enhance stability

    • Incorporation of cholesterol or other stabilizing agents

  • Buffer optimization:

    • pH screening typically between 6.5-8.0

    • Addition of stabilizing agents (glycerol, trehalose, sucrose)

    • Inclusion of reducing agents if cysteine residues are present

    • Testing various salt types and concentrations

  • Protein engineering approaches:

    • Truncation of flexible regions that promote aggregation

    • Introduction of stabilizing mutations identified through directed evolution

    • Fusion with solubilizing partners (MBP, SUMO)

    • Surface entropy reduction to improve crystallizability

Successful purification of membrane proteins like yccF often requires iterative optimization through systematic screening of conditions, with careful monitoring of protein quality at each step using techniques like size exclusion chromatography and dynamic light scattering.

What approaches can resolve inconsistent results in yccF functional assays?

Addressing variability in membrane protein functional studies:

  • Protein quality assessment:

    • Implement rigorous quality control metrics (SEC-MALS, DLS, thermal stability)

    • Ensure batch-to-batch consistency through standardized protocols

    • Characterize protein state before each assay (oligomeric state, modification status)

  • Assay standardization:

    • Develop detailed standard operating procedures

    • Use internal controls for normalization

    • Include positive and negative controls in each experiment

    • Validate all reagents and buffers before use

  • Experimental design considerations:

    • Perform proper statistical power calculations to determine sample size

    • Use randomization and blinding where appropriate

    • Include technical and biological replicates

    • Control for environmental variables (temperature, timing, equipment)

  • Data analysis approaches:

    • Apply appropriate statistical methods for the specific experimental design

    • Use multiple statistical approaches to confirm results

    • Consider Bayesian methods for integrating prior knowledge

    • Implement standardized data processing workflows

When encountering inconsistent results, systematic troubleshooting following the scientific method is essential: formulate hypotheses about sources of variability, design controlled experiments to test each hypothesis, and implement solutions based on findings .

How can I develop specific antibodies against yccF for research applications?

Strategies for developing effective antibodies against membrane proteins:

  • Antigen design considerations:

    • Use of hydrophilic loops or domains as immunogens

    • Synthetic peptides corresponding to exposed regions

    • Recombinant fragments excluding transmembrane domains

    • Whole protein in native-like membrane environments (nanodiscs, liposomes)

  • Immunization approaches:

    • Use of multiple host species for diverse antibody repertoires

    • Prime-boost strategies with different antigen forms

    • Adjuvant selection appropriate for membrane protein antigens

    • DNA immunization for native protein expression in vivo

  • Screening and validation methods:

    • ELISA against multiple forms of the antigen

    • Western blotting under various conditions (native, denatured)

    • Immunofluorescence in cells expressing or lacking the target

    • Immunoprecipitation to confirm native protein recognition

  • Antibody engineering options:

    • Monoclonal antibody development for specificity

    • Antibody fragment generation (Fab, scFv) for improved penetration

    • Recombinant antibody production for reproducibility

    • Affinity maturation if higher specificity is required

Development of antibodies against membrane proteins is challenging due to their hydrophobicity and limited exposed regions. Similar to approaches used for other membrane proteins, focusing on hydrophilic loops or using conformation-specific immunization strategies may be most successful for yccF .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.