Recombinant Inner membrane protein ydgC (ydgC)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

Recombinant Inner membrane protein ydgC (ydgC) is a bacterial membrane protein expressed in heterologous systems, primarily studied for its structural and functional properties. While its exact biological role remains unclear, it is notable for its dual-topology membrane insertion mechanism and association with transmembrane helices. The protein is encoded by the ydgC gene, which is conserved in Gram-negative bacteria like Escherichia coli and Shigella flexneri . Recombinant ydgC is produced in mammalian cells or E. coli strains optimized for membrane protein expression .

Functional Insights

While the specific biological function of ydgC remains uncharacterized, its dual-topology suggests roles in membrane remodeling, ion transport, or protein folding. Studies on analogous proteins (e.g., EmrE) indicate that dual-topology proteins often participate in stress responses or antimicrobial resistance . Recombinant ydgC is used in structural biology to study membrane protein insertion mechanisms, particularly how sequence determinants influence topology .

Recombinant Production and Purification

Production Systems:

  • Source: Mammalian cells or engineered E. coli strains .

  • Purity: >85% as determined by SDS-PAGE .

  • Tagging: Variable tags (e.g., HA, StrepII) for detection and purification .

Applications:

  • Structural Studies: Used to investigate dual-topology mechanisms and transmembrane helix dynamics .

  • Membrane Protein Engineering: Serves as a model for optimizing heterologous expression in E. coli .

Challenges:

  • Low-Yield Expression: Requires specialized strains (e.g., BL21ΔABCF) to improve membrane localization .

  • Aggregation Risk: Recombinant ydgC may form insoluble aggregates unless purified under optimized buffer conditions .

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we are happy to accommodate specific requirements. Please indicate your preferred format in your order notes and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, and can serve as a reference for your own preparations.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
We prioritize fulfilling your specified tag type requirements. Please inform us of your desired tag type, and we will endeavor to develop it for your product.
Synonyms
ydgC; Z2608; ECs2313; Inner membrane protein YdgC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
ydgC
Target Protein Sequence
MGLVIKAALGALVVLLIGVLAKTKNYYIAGLIPLFPTFALIAHYIVASERGIEALRATII FSMWSIIPYFVYLVSLWYFTGMMRLPAAFVGSVACWGISAWVLIICWIKLH
Uniprot No.

Target Background

Database Links

KEGG: ece:Z2608

STRING: 155864.Z2608

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does ydgC differ from other inner membrane proteins like YidC?

While both ydgC and YidC are inner membrane proteins in E. coli, they differ in several aspects. YidC is well characterized as an essential component in insertion, translocation, and assembly of membrane proteins . In contrast, ydgC has a more specialized role and differs in structural characteristics. YidC has been extensively purified using optimized buffer conditions that prevent aggregation during purification , whereas specific purification protocols for ydgC are still being refined. Functionally, YidC operates as part of the Sec translocon-associated pathway as well as independently, while ydgC functions through distinct molecular mechanisms that are still being elucidated in current research.

What expression systems are most suitable for recombinant production of ydgC?

The most suitable expression systems for recombinant ydgC production are specialized E. coli strains designed for membrane protein expression. The BL21ΔABCF quadruple mutant strain has proven effective for many outer membrane proteins and can be adapted for inner membrane proteins like ydgC . For optimal expression:

  • Transform the expression plasmid containing the ydgC gene into BL21ΔABCF or similar specialized strains

  • Culture cells at reduced temperatures (30°C rather than 37°C) to prevent inclusion body formation

  • Induce expression during mid-log phase (OD600 ~0.5) using either IPTG (1 mM) or anhydrotetracycline (50 ng/ml) depending on the promoter system

  • Continue expression for approximately 2 hours post-induction before harvesting cells for protein extraction

This approach minimizes toxicity issues commonly encountered with membrane protein overexpression.

What strategies can overcome aggregation issues during ydgC purification?

Aggregation during purification is a common challenge with membrane proteins including ydgC. Based on successful approaches with similar proteins like YidC, the following methodological strategies are recommended:

  • Implement a rapid stability screening strategy using gel filtration chromatography to identify optimal buffer conditions

  • Test multiple detergent combinations at various concentrations (typically 0.03-1%)

  • Include stabilizing agents such as glycerol (10-20%) or specific lipids that mimic the native membrane environment

  • Screen pH ranges (typically pH 6.5-8.0) and salt concentrations (100-500 mM NaCl)

This approach requires as little as 10 μg of protein per condition tested and can be completed in under 15 minutes per screening condition . The optimal buffer identified through this screening can then be used throughout the purification process, significantly reducing aggregation and precipitation issues that have previously hampered structural studies of membrane proteins.

How can researchers differentiate between functional and non-functional recombinant ydgC?

Differentiating between functional and non-functional recombinant ydgC requires multiple complementary approaches:

ApproachMethodologyExpected Outcome for Functional Protein
In vitro translocation assaysReconstitute purified ydgC into liposomes and assess translocation of model substratesSuccessful translocation of substrate proteins across the membrane
Complementation studiesExpress recombinant ydgC in ydgC-knockout strains and assess phenotype rescueRestoration of wild-type phenotype
Circular dichroism spectroscopyAnalyze secondary structure elementsCharacteristic α-helical patterns typical of functional membrane proteins
Binding assays with known partnersCo-immunoprecipitation or pull-down assaysSpecific interaction with known binding partners

These methodological approaches should be used in combination rather than relying on a single technique to conclusively determine functionality . Particularly, complementation studies provide strong evidence for functionality in the native cellular context.

What are the critical factors affecting the stability of purified ydgC?

The stability of purified ydgC, like other membrane proteins, is influenced by several critical factors that must be methodically controlled:

  • Detergent selection: Mild non-ionic detergents (DDM, LMNG) better preserve protein structure compared to harsh ionic detergents (SDS)

  • Lipid supplementation: Addition of specific lipids (phosphatidylethanolamine, cardiolipin) at 0.1-0.2 mg/ml can significantly enhance stability

  • Storage temperature: +4°C is optimal for short-term storage, while flash-freezing in liquid nitrogen with cryoprotectants is recommended for long-term storage

  • Buffer composition: The presence of stabilizing agents like glycerol (10-20%) and appropriate salt concentration (typically 150-300 mM NaCl)

Through systematic optimization of these parameters, purified ydgC can remain stable for weeks at +4°C, making it suitable for structural and functional studies . The stability screening approach described earlier provides a methodological framework for identifying the optimal conditions specific to ydgC.

How should researchers design expression vectors for optimal ydgC production?

Designing expression vectors for optimal ydgC production requires careful consideration of several elements:

  • Promoter selection: Inducible promoters like T7 or tet provide controlled expression, with tet systems offering more fine-tuned regulation for toxic membrane proteins

  • Fusion tags: C-terminal tags are generally preferred as N-terminal tags may interfere with membrane insertion

  • Tag options:

    • His6 or His10 tags for purification

    • GFP fusion for monitoring expression and folding

    • TEV or PreScission protease sites for tag removal

  • Codon optimization: Adapt codons to E. coli preference, particularly avoiding rare codons in high-expression regions

The vector backbone should contain appropriate antibiotic resistance markers and origins of replication compatible with expression strains optimized for membrane proteins . Additionally, including a ribosome binding site with optimal spacing (7-9 nucleotides from the start codon) enhances translation efficiency.

What experimental controls are essential when characterizing recombinant ydgC?

When characterizing recombinant ydgC, the following experimental controls are methodologically essential:

  • Negative controls:

    • Empty vector transformants to assess background effects

    • Non-induced samples to measure leaky expression

    • Heat-denatured protein samples to distinguish between functional and non-functional states

  • Positive controls:

    • Well-characterized membrane proteins (like YidC) processed in parallel

    • Native ydgC (if available) for direct comparison

  • Process controls:

    • Detergent-only samples to identify detergent-specific effects

    • Time-course samples to monitor stability degradation

Each experiment should incorporate these controls to allow for rigorous interpretation of results and identification of artifacts that might arise during membrane protein work . Additionally, biological replicates (minimum of three) are necessary to establish statistical significance in any quantitative measurements.

How can researchers optimize solubilization conditions for ydgC extraction?

Optimizing solubilization conditions for ydgC extraction requires a systematic approach:

  • Detergent screening: Test a panel of detergents including:

    • Mild (DDM, LMNG, Digitonin)

    • Moderate (OG, LDAO)

    • Harsh (SDS, FC-12) - useful as positive extraction controls

  • Solubilization parameters optimization:

    • Detergent concentration: Usually 1-2% for initial solubilization, reduced to 2-3× CMC afterward

    • Temperature: Compare 4°C vs. room temperature

    • Duration: Test 1-hour vs. overnight solubilization

    • Buffer composition: Vary pH (6.5-8.0) and salt concentration (100-500 mM)

  • Efficiency assessment:

    • Compare solubilized fraction to total membrane fraction by Western blot

    • Evaluate functional retention using activity assays

A successful optimization will yield >80% extraction efficiency while maintaining protein functionality . The optimal conditions must be determined empirically as they often vary between different membrane proteins, even those with structural similarities.

How should researchers interpret conflicting results between in vitro and in vivo studies of ydgC?

When faced with conflicting results between in vitro and in vivo studies of ydgC, researchers should apply the following methodological approach:

  • Assess experimental contexts:

    • In vitro studies lack cellular complexity but offer controlled environments

    • In vivo studies provide physiological relevance but with multiple variables

  • Evaluate potential explanations:

    • Detergent effects may alter protein conformation in vitro

    • Missing cofactors or interaction partners in reconstituted systems

    • Post-translational modifications present only in cellular environments

    • Differences in local concentration and membrane composition

  • Design bridging experiments:

    • Spheroplast studies that maintain cellular environment while allowing controlled access

    • Reconstitution into native membrane extracts rather than synthetic lipids

    • Gradual complexity approaches that systematically add cellular components

  • Data integration framework:

    • Develop models that accommodate both datasets by identifying boundary conditions

    • Use computational approaches to identify parameters that could explain discrepancies

This analytical approach transforms conflicting results into deeper mechanistic insights about context-dependent protein function . The resolution often reveals nuanced aspects of membrane protein biology that neither approach alone could identify.

What statistical approaches are most appropriate for analyzing ydgC functional assay data?

For analyzing ydgC functional assay data, researchers should employ these statistical approaches:

How can structural predictions inform functional studies of ydgC?

Structural predictions can methodologically inform functional studies of ydgC through the following approaches:

  • Transmembrane topology prediction:

    • Use algorithms like TMHMM, Phobius, or TOPCONS to predict membrane-spanning regions

    • Design truncation constructs to test domain-specific functions

    • Guide the selection of sites for introducing reporter groups or fluorescent labels

  • Homology modeling:

    • Identify structural homologs with known functions

    • Predict potential binding pockets and interaction surfaces

    • Generate testable hypotheses about residues critical for function

  • Molecular dynamics simulations:

    • Model protein behavior in different membrane environments

    • Predict conformational changes in response to substrates or conditions

    • Identify potential allosteric sites

  • Integration with experimental data:

    • Use predicted structures to interpret crosslinking or mutagenesis results

    • Design targeted mutations based on structural features

    • Develop binding assays focused on predicted interaction sites

This iterative process between computational prediction and experimental validation accelerates functional characterization by focusing laboratory efforts on the most promising aspects of protein function . For membrane proteins like ydgC, these approaches are particularly valuable given the challenges of obtaining high-resolution experimental structures.

What approaches can resolve low expression yields of recombinant ydgC?

Low expression yields of recombinant ydgC can be methodically addressed through the following strategies:

  • Strain optimization:

    • Test specialized strains like BL21ΔABCF designed for membrane protein expression

    • Consider C41/C43(DE3) strains that better tolerate toxic membrane proteins

    • Evaluate Lemo21(DE3) for tunable expression levels

  • Expression condition optimization:

    • Reduce induction temperature to 18-30°C

    • Test various inducer concentrations (typically 0.1-1.0 mM IPTG or 10-100 ng/ml anhydrotetracycline)

    • Extend expression time (overnight at lower temperatures)

    • Supplement media with membrane components (e.g., additional phospholipids)

  • Vector modifications:

    • Adjust the strength of the ribosome binding site

    • Test different signal sequences for membrane targeting

    • Consider dual-vector systems separating toxic elements

  • Media formulation:

    • Compare rich (TB, 2YT) versus defined media

    • Test supplementation with specific ions or cofactors

    • Consider auto-induction media for gradual expression

These approaches have been successfully applied to other challenging membrane proteins and can be adapted specifically for ydgC . Systematic documentation of each condition tested is crucial for identifying optimal expression parameters.

How can researchers troubleshoot protein misfolding during ydgC expression?

Troubleshooting protein misfolding during ydgC expression requires a systematic approach:

Problem IndicatorPossible CausesMethodological Solutions
Inclusion body formationExpression rate exceeds membrane insertion capacityLower temperature (18-25°C), reduce inducer concentration, use weaker promoters
Low GFP fluorescence (with GFP fusion)Impaired folding in membraneCo-express molecular chaperones, optimize growth media with specific lipids
Aberrant migration on SDS-PAGEIncomplete denaturation, aggregationOptimize sample preparation (temperature, time with SDS), use mild solubilization
Poor function in activity assaysIncorrect folding or assemblyScreen different detergents for extraction, include stabilizing lipids

Additionally, researchers should consider:

  • Testing expression in different membrane compartments

  • Co-expressing known interaction partners to stabilize folding

  • Using fusion partners known to enhance membrane protein folding

  • Implementing directed evolution approaches to identify better-folding variants

These strategies have successfully resolved misfolding issues for various membrane proteins and can be adapted for ydgC . The approach must be iterative, with each modification evaluated for its impact on folding.

What solutions exist for addressing heterogeneity in purified ydgC preparations?

Heterogeneity in purified ydgC preparations can be addressed through these methodological solutions:

  • Pre-purification strategies:

    • Optimize membrane isolation to remove contaminants before solubilization

    • Implement selective extraction using different detergent concentrations

    • Use density gradient centrifugation to separate membrane fractions

  • Chromatographic approaches:

    • Sequential purification combining multiple principles (affinity, ion exchange, size exclusion)

    • Include an intermediate reverse-purification step to remove co-purifying contaminants

    • Optimize column gradient profiles for better separation

  • Homogeneity assessment techniques:

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Analytical ultracentrifugation to identify distinct species

    • Native PAGE combined with Western blotting

  • Post-purification processing:

    • Targeted proteolysis to remove flexible regions causing heterogeneity

    • Buffer screening using the gel filtration approach to identify stabilizing conditions

    • Apply detergent exchange to improve homogeneity

These approaches can significantly reduce heterogeneity, which is critical for structural studies and consistent functional assays . The rapid gel filtration screening strategy is particularly valuable for identifying conditions that promote homogeneity while requiring minimal protein (10 μg per condition).

How can ydgC be used in studies of bacterial membrane biogenesis?

Recombinant ydgC can be methodologically applied to study bacterial membrane biogenesis through:

  • In vivo approaches:

    • Create conditional ydgC depletion strains to observe membrane composition changes

    • Express tagged versions to track localization during membrane synthesis

    • Perform pulse-chase studies to monitor protein integration kinetics

  • In vitro reconstitution systems:

    • Develop proteoliposomes containing purified ydgC to study minimal insertion systems

    • Create hybrid vesicles with varying lipid compositions to assess environmental requirements

    • Establish cell-free expression systems with ydgC-containing membranes

  • Interaction studies:

    • Use proximity labeling techniques (BioID, APEX) with ydgC as bait

    • Perform systematic co-immunoprecipitation with other membrane biogenesis factors

    • Apply chemical crosslinking to capture transient interactions

  • Functional assays:

    • Measure membrane protein insertion efficiency in the presence/absence of ydgC

    • Assess membrane integrity with fluorescent probes in ydgC-depleted cells

    • Monitor lipid distribution using specific dyes or mass spectrometry

These approaches can provide insights into the broader membrane proteostasis network of which ydgC is a part . The combination of genetic, biochemical, and biophysical methods enables a comprehensive understanding of ydgC's role in bacterial membrane biogenesis.

What are the current limitations in structural studies of ydgC and how might they be overcome?

Current limitations in structural studies of ydgC and methodological approaches to overcome them include:

  • Protein stability challenges:

    • Limitation: Membrane proteins often destabilize in detergent solutions

    • Solution: Implement the rapid gel filtration screening to identify optimal stabilizing conditions

    • Solution: Explore new solubilization approaches like SMALPs (styrene-maleic acid lipid particles) that maintain the native lipid environment

  • Conformational heterogeneity:

    • Limitation: Multiple functional states complicate structure determination

    • Solution: Use conformation-specific antibodies or nanobodies to lock specific states

    • Solution: Apply hydrogen-deuterium exchange mass spectrometry to map dynamic regions

  • Crystallization difficulties:

    • Limitation: Detergent micelles limit crystal contact formation

    • Solution: Try in meso crystallization methods using lipidic cubic phases

    • Solution: Engineer fusion proteins with crystallization chaperones (e.g., T4 lysozyme)

  • Cryo-EM challenges:

    • Limitation: Small size of membrane proteins reduces contrast

    • Solution: Use Volta phase plates to enhance contrast

    • Solution: Apply focused classification algorithms to sort conformational states

These methodological approaches have successfully resolved structures of challenging membrane proteins and represent promising strategies for ydgC . Additionally, integrative structural biology combining multiple techniques (X-ray, NMR, cryo-EM, crosslinking-MS) offers a powerful approach to overcome individual method limitations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.