Recombinant Inner membrane protein yhaH (yhaH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
yhaH; Z4457; ECs3985; Inner membrane protein YhaH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
yhaH
Target Protein Sequence
MDWYLKVLKNYVGFRGRARRKEYWMFILVNIIFTFVLGLLDKMLGWQRAGGEGILTTIYG ILVFLPWWAVQFRRLHDTDRSAWWALLFLIPFIGWLIIIVFNCQAGTPGENRFGPDPKLE P
Uniprot No.

Target Background

Database Links

KEGG: ece:Z4457

STRING: 155864.Z4457

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is yhaH and what is its localization in Escherichia coli?

yhaH is an integral membrane protein localized to the inner membrane of Escherichia coli. Similar to other inner membrane proteins such as YhcB, it is embedded within the cytoplasmic membrane with specific topology . While detailed characterization of yhaH is still ongoing, it belongs to the class of proteins that participate in the structural integrity and functional aspects of the bacterial cell envelope. Inner membrane proteins typically contain hydrophobic transmembrane domains that anchor them within the lipid bilayer, with hydrophilic domains extending into either the cytoplasm or periplasm.

What expression systems are most effective for recombinant inner membrane protein production?

Expression vectors with tightly regulated promoters (such as T7 or tet promoters) allow for controlled induction, which is critical for membrane proteins that may be toxic when overexpressed. For optimal results, induction conditions should be carefully titrated, typically using lower inducer concentrations (e.g., 50 ng/ml anhydrotetracycline or 0.1-0.5 mM IPTG) and reduced temperatures (16-30°C rather than 37°C) .

What are the common challenges in solubilizing and purifying inner membrane proteins?

Inner membrane proteins like yhaH present unique challenges during purification due to their hydrophobic nature. The primary challenges include:

  • Efficient extraction from the membrane while maintaining native structure

  • Prevention of aggregation during purification

  • Selection of appropriate detergents or amphipathic polymers

For successful solubilization, a two-step membrane isolation approach is recommended. First, isolate the membrane fraction through differential centrifugation after cell lysis. Second, selectively solubilize the protein using mild detergents such as n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin. These detergents effectively extract the protein while preserving structural integrity.

For purification, immobilized metal affinity chromatography (IMAC) using polyhistidine tags is commonly employed, followed by size exclusion chromatography to remove aggregates and obtain homogeneous protein preparations. Throughout the purification process, it is critical to maintain the detergent concentration above its critical micelle concentration (CMC) to prevent protein aggregation.

How can bacterial two-hybrid systems be utilized to identify protein interactions of inner membrane proteins?

Bacterial two-hybrid (BACTH) systems represent a powerful approach for investigating protein-protein interactions involving inner membrane proteins like yhaH. Based on the methodology used for studying YhcB protein interactions, the adenylate cyclase-based BACTH system is particularly suitable for membrane proteins .

In this system, two complementary fragments (T18 and T25) derived from the adenylate cyclase of Bordetella pertussis are fused to proteins of interest. When expressed in a cyaA (adenylate cyclase) mutant strain, protein interactions bring these fragments into proximity, reconstituting adenylate cyclase activity. This results in cAMP production, which activates the transcription of reporter genes (typically lacZ) .

For inner membrane proteins, key considerations include:

  • Proper orientation of fusion constructs based on protein topology prediction

  • Fusion position (N- or C-terminal) based on predicted cytoplasmic domains

  • Use of appropriate controls to verify specificity of interactions

For example, when studying YhcB interactions, researchers constructed YhcB-T18 and T25-RodZ fusions, positioning the adenylate cyclase fragments on the cytoplasmic side of the membrane . The interaction strength can be quantified by measuring β-galactosidase activity, as shown in the following data from YhcB interaction studies:

β-gal activityYhcB-T18T18 (control)
T25-MurG269.6 ± 60.771.4 ± 5.5
T25-MreB68.0 ± 9.273.7 ± 9.2
T25-MreC476.6 ± 3.071.2 ± 6.3
T25-MreD254.5 ± 52.475.6 ± 22.5
RodA-T25379.7 ± 19.182.7 ± 18.6
T25-RodZ701.1 ± 211.780.6 ± 6.1
T25-YciS853.4 ± 685.678.2 ± 2.1
T25 (control)59.3 ± 24.431.1 ± 21.6

This methodology could be readily adapted to study yhaH interactions with other membrane or cytoplasmic proteins .

What approaches can be utilized to investigate the function of poorly characterized inner membrane proteins?

For poorly characterized inner membrane proteins like yhaH, a multi-faceted functional genomics approach is recommended:

  • Synthetic lethality screening: Construct double deletion mutants with genes of known function to identify functional relationships. For example, the synthetic lethality between yhcB and rodZ deletions revealed their functional connection in cell envelope biogenesis .

  • Phenotypic profiling: Systematically test the deletion mutant under various stress conditions (temperature, pH, antibiotics, osmolarity) to identify conditions where the protein becomes essential. The yhcB deletion mutant, for instance, showed impaired growth at critically high temperatures and reduced biofilm formation .

  • Protein interaction network mapping: Using techniques like BACTH or pull-down assays coupled with mass spectrometry to identify interaction partners. The functional context of these interactors can provide clues about the protein's role. YhcB's interactions with cell shape proteins (RodZ, MreCD, RodA) and enzymes involved in peptidoglycan synthesis (MurG) suggested its role in cell envelope biogenesis .

  • Localization studies: Using fluorescent protein fusions to determine subcellular localization patterns during different growth phases or stress conditions.

  • Heterologous complementation: Test whether yhaH can complement phenotypes of mutants lacking other membrane proteins with known functions.

How can deletion mutant strains be engineered to enhance recombinant membrane protein expression?

Engineering deletion mutant strains can significantly improve the expression of recombinant membrane proteins by reducing competition for membrane insertion machinery and chaperones. The BL21ΔABCF strain, with deletions in four major outer membrane proteins, exemplifies this approach and provides insights applicable to inner membrane protein expression .

Key strategies include:

  • Deletion of abundant endogenous membrane proteins: Removing major membrane proteins reduces competition for the membrane insertion machinery, potentially increasing the yield of the recombinant protein of interest.

  • Engineering protein quality control systems: Modifying or overexpressing chaperones (DnaK-DnaJ-GrpE, GroEL-GroES) and proteases to enhance proper folding and reduce degradation of overexpressed membrane proteins.

  • Codon optimization: Adjusting codons to match the tRNA pool of the expression host, which is particularly important for membrane proteins that may contain rare codons.

The effectiveness of deletion mutants for enhancing expression is demonstrated by the improved production of outer membrane proteins in BL21ΔABCF compared to the parent strain BL21(DE3), as assessed by both SDS-PAGE and whole-cell ELISA. This approach resulted in not only higher expression levels but also proper membrane insertion of the target proteins .

What are the latest methodologies for structural characterization of inner membrane proteins like yhaH?

Structural characterization of inner membrane proteins remains challenging but has seen significant advancements:

  • Cryo-electron microscopy (cryo-EM): This technique has revolutionized membrane protein structural biology by eliminating the need for crystallization. Sample preparation involves purifying the protein in detergent micelles or nanodiscs, followed by vitrification and imaging. Recent advances in direct electron detectors and image processing algorithms have enabled near-atomic resolution structures of membrane proteins.

  • Solid-state NMR spectroscopy: This approach allows the study of membrane proteins in lipid environments that closely mimic their native setting. It provides valuable information about protein dynamics and ligand interactions without the need for crystallization.

  • Lipid nanodiscs and styrene-maleic acid lipid particles (SMALPs): These systems enable the extraction and purification of membrane proteins within a disc of native or defined lipids, maintaining a more native-like environment than traditional detergent micelles. This approach is particularly valuable for functional and structural studies of inner membrane proteins.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique provides information about protein dynamics and solvent accessibility, helping to identify functional domains and conformational changes upon ligand binding or protein-protein interactions.

  • Integrative structural biology: Combining multiple techniques (X-ray crystallography, cryo-EM, NMR, computational modeling) to overcome the limitations of individual methods and generate comprehensive structural models.

What strategies can be employed to improve membrane insertion and folding of recombinant inner membrane proteins?

Several strategies can enhance the proper insertion and folding of recombinant inner membrane proteins:

  • Reduced expression temperatures: Lowering the culture temperature to 16-30°C after induction slows protein synthesis, allowing more time for proper membrane insertion and folding. This approach has been successful for various membrane proteins, reducing the formation of inclusion bodies .

  • Optimization of inducer concentration: Using lower concentrations of inducers (e.g., 0.1 mM IPTG instead of 1 mM, or 50 ng/ml anhydrotetracycline) can prevent overwhelming the membrane insertion machinery .

  • Co-expression of chaperones and folding modulators: Co-expressing molecular chaperones (DnaK-DnaJ-GrpE, GroEL-GroES) or membrane protein-specific folding factors can enhance proper folding and membrane insertion.

  • Use of fusion partners: N-terminal fusion partners like MBP (maltose-binding protein) or Mistic (membrane-integrating sequence for translation of integral membrane protein constructs) can improve membrane targeting and insertion.

  • Engineered signal sequences: Optimizing or replacing native signal sequences with those known to efficiently direct proteins to the inner membrane can improve targeting and insertion efficiency.

  • Modified growth media and additives: Supplementing growth media with specific additives like glycerol (5-10%) or specific lipids can stabilize membrane proteins during expression.

How can synthetic lethality be used to infer functional relationships between inner membrane proteins?

Synthetic lethality occurs when the combination of two non-lethal mutations results in cell death. This genetic interaction can reveal functional relationships between genes, particularly those involved in parallel or compensatory pathways. For inner membrane proteins like yhaH, synthetic lethality approaches can provide valuable insights into their function:

  • Construction of conditional mutants: For studying synthetic lethality involving essential genes, conditional expression systems are crucial. As demonstrated with yhcB and rodZ, researchers constructed a strain harboring double deletion mutations complemented with an inducible yhcB gene on the chromosome. This allowed controlled depletion of YhcB in a rodZ deletion background, revealing that the simultaneous loss of both proteins is lethal .

  • High-throughput synthetic genetic arrays: Systematic construction of double mutants by combining a query mutation (e.g., yhaH deletion) with an ordered array of single gene deletions to identify genetic interactions on a genome-wide scale.

  • Interpretation of synthetic lethal interactions: The synthetic lethality between yhcB and rodZ suggested that these proteins function in parallel or compensatory pathways involved in cell envelope biogenesis. This was further supported by protein interaction studies showing that both proteins interact with components of the cell shape maintenance machinery .

  • Validation through complementation studies: To confirm the specificity of synthetic lethal interactions, complementation with plasmid-expressed wild-type or mutant versions of the genes can reveal which domains or functions are critical for viability.

What quality control metrics should be applied when assessing recombinant inner membrane protein preparations?

Rigorous quality control is essential for ensuring the reliability of studies involving recombinant inner membrane proteins. Key metrics include:

  • Purity assessment:

    • SDS-PAGE analysis with Coomassie or silver staining

    • Size exclusion chromatography profiles to evaluate monodispersity

    • Mass spectrometry to confirm protein identity and detect contaminants

  • Proper membrane insertion and folding:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Fluorescence spectroscopy to evaluate tertiary structure integrity

    • Protease accessibility assays to confirm proper membrane topology

    • Whole-cell ELISA for surface-exposed epitopes if applicable

  • Functional integrity:

    • Binding assays for ligand interaction (if function is known)

    • Activity assays specific to the protein's function

    • Thermal stability assays (DSF or nanoDSF) to assess protein stability

  • Membrane incorporation efficiency:

    • Western blot analysis of membrane fractions versus inclusion bodies

    • Comparison of expression levels between different strains, as demonstrated for outer membrane proteins in BL21(DE3) versus BL21ΔABCF

  • Detergent exchange compatibility:

    • Stability in different detergents assessed by size exclusion chromatography

    • Maintenance of structure and function after detergent exchange

How can structural insights from inner membrane proteins inform antimicrobial drug development?

Inner membrane proteins represent attractive targets for antimicrobial development due to their essential roles in bacterial physiology and their accessibility to small molecules. Structural and functional insights from proteins like yhaH can inform drug development strategies:

  • Identification of druggable sites: Structural characterization can reveal potential binding pockets suitable for small molecule inhibitors. Inner membrane proteins often contain hydrophilic cavities within their transmembrane domains that can accommodate small molecules.

  • Structure-based drug design: Atomic-resolution structures enable rational design of inhibitors that specifically target essential inner membrane proteins. This approach has been successful for targeting proteins involved in cell envelope biogenesis, which is especially relevant considering YhcB's interaction with cell shape proteins and potential role in peptidoglycan synthesis .

  • Biofilm inhibition strategies: The observation that deletion of certain inner membrane proteins (such as yhcB) reduces biofilm formation suggests that targeting these proteins could inhibit biofilm development, a critical factor in pathogenicity . This could lead to novel anti-biofilm agents that don't necessarily kill bacteria but reduce virulence.

  • Targeting protein-protein interactions: Knowledge of specific interactions, such as those identified between YhcB and cell shape proteins (RodZ, MreCD, RodA), could inspire the development of peptide mimetics or small molecules that disrupt these essential interactions .

How can comparative genomics inform functional annotation of poorly characterized inner membrane proteins?

Comparative genomics approaches offer powerful strategies for elucidating the functions of poorly characterized proteins like yhaH:

  • Phylogenetic profiling: Analyzing the co-occurrence patterns of yhaH across bacterial species can identify genes with similar evolutionary distributions, suggesting functional relationships. Proteins involved in the same biological process often show correlated presence or absence across species.

  • Genomic context analysis: Examining the organization of genes surrounding yhaH in various bacterial genomes can provide functional clues, as functionally related genes are often clustered in operons or found in conserved genomic neighborhoods.

  • Domain architecture analysis: Identifying conserved domains or motifs within yhaH and comparing them with proteins of known function can suggest potential biochemical activities or interaction capabilities.

  • Evolutionary rate analysis: Comparing the evolutionary rates of yhaH across different bacterial lineages can indicate functional constraints. Higher conservation usually suggests essential functions.

  • Integration with experimental data: Combining comparative genomics predictions with experimental data, such as the protein interaction networks identified for YhcB, can validate and refine functional hypotheses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.