Recombinant Inner membrane protein yiaA (yiaA)

Shipped with Ice Packs
In Stock

Description

Expression Platforms

  • Baculovirus-insect cell systems: Yields soluble protein with post-translational modifications .

  • Cell-free expression: Enables rapid production without cellular toxicity .

Purification Protocols

  • Chromatography: Affinity purification (e.g., Ni-NTA for His-tagged variants) followed by size-exclusion chromatography .

  • Purity: >85% as verified by SDS-PAGE .

Role in Membrane Biology

  • Hypothesized Functions:

    • Potential involvement in sulfur metabolism or redox regulation due to its rhodanese-like domain .

    • May contribute to membrane protein assembly or lipid organization, inferred from its classification within the YiaAB family .

Genetic Context

  • Located in a conserved operon with grxC, secB, and gpsA, which are linked to disulfide bond reduction, protein secretion, and lipid synthesis .

Experimental Observations

  • Transposon Library Screening: Identified as a genetic locus influencing membrane protein expression efficiency in E. coli .

  • Co-Expression Effects: Overexpression of homologous proteins (e.g., YibN) enhances membrane lipid production and protein insertion, suggesting indirect functional linkages .

Applications in Research

  • Antigen Production: Used to generate antibodies for immunoblotting or immunofluorescence .

  • Structural Studies: Suitable for crystallography or cryo-EM due to high purity and stability .

  • Membrane Protein Interaction Assays: Employed in pull-down experiments to identify binding partners .

Research Limitations and Future Directions

  • Functional Data Gap: Limited direct studies on yiaA’s mechanistic role; most insights are extrapolated from homologous proteins like YidC/YibN .

  • Opportunities:

    • Structural characterization to resolve its catalytic or regulatory domains.

    • Knockout studies to elucidate phenotypic impacts under stress conditions.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery time estimates, please consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please inform us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
yiaA; SF3606; S4163; Inner membrane protein YiaA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Shigella flexneri
Target Names
yiaA
Target Protein Sequence
MDNKISTYSPAFSIVSWIALVGGIVTYLLGLWNAEMQLNEKGYYFAVLVLGLFSAASYQK TVRDKYEGIPTTSIYYMTCLTVFIISVALLMVGLWNATLLLSEKGFYGLAFFLSLFGAVA VQKNIRDAGINPPKETQVTQEEYSE
Uniprot No.

Target Background

Database Links

KEGG: sfl:SF3606

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal expression systems for producing recombinant YiaA protein?

For optimal expression of recombinant YiaA, E. coli remains the primary host system due to its well-characterized genetics and rapid growth. The recommended approach involves:

  • Vector Selection: pRha vectors with tunable rhamnose promoters are preferred as they allow precise control of expression levels, preventing toxic overexpression effects .

  • Signal Peptide Selection: For periplasmic production, test multiple signal peptides including:

    • DsbA signal peptide

    • OmpA signal peptide

    • PhoA signal peptide

    • Hbp signal peptide

  • Expression Conditions:

    • Induce at mid-log phase (OD600 ~0.6-0.8)

    • Use lower temperatures (16-25°C) during induction

    • Optimize inducer concentration through titration experiments

Research by Karyolaimos et al. demonstrated that tuning production rates rather than maximizing them yields higher functional protein . When using the rhamnose promoter in a Δrha operon deletion strain background, researchers observed increased Sec-translocon capacity, which improved periplasmic protein yields.

What experimental design strategies are most effective for studying YiaA function?

When designing experiments to study YiaA, consider the following framework:

Table 1: Experimental Design Framework for YiaA Studies

Design ElementApproachRationale
RandomizationRandom assignment of bacterial cultures to treatment groupsReduces systematic bias and controls for unknown variables
ReplicationMinimum 3-5 biological replicatesIncreases precision of estimates and statistical power
BlockingGroup experiments by batch/dayControls for day-to-day variation in laboratory conditions 10
ControlsInclude wild-type strains and empty vector controlsEstablishes baseline for comparison
Factorial DesignTest multiple variables simultaneously (e.g., temperature, media, induction time)Reveals interaction effects between variables

When implementing a crossover design to study YiaA function under different conditions, use the mathematical model:

Yijk=μ+τi+πj+βk+ϵijkY_{ijk} = \mu + \tau_i + \pi_j + \beta_k + \epsilon_{ijk}

Where:

  • τi\tau_i represents the treatment effect

  • πj\pi_j represents the period effect

  • βk\beta_k represents the subject effect (individual baseline differences)

This approach is particularly valuable when studying YiaA's effects on cell growth under various stress conditions, as it controls for individual differences by using each subject as its own control.

What are the optimized conditions for purifying functional YiaA protein?

Purifying membrane proteins like YiaA requires specialized techniques to maintain their native structure and function:

  • Membrane Fractionation:

    • Harvest cells at late stationary phase (when YiaA expression is highest)

    • Suspend in TE buffer (50 mM Tris-HCl at pH 8.0, 5 mM EDTA) with protease inhibitor cocktail

    • Lyse cells with lysozyme

    • Remove cellular debris by centrifugation at 4,000 rpm for 5 min at 4°C

    • Centrifuge supernatant at 50,000 rpm for 1.5 h at 4°C to separate membrane fractions

  • Detergent Screening:
    Based on approaches used for similar membrane proteins like YidC, employ rapid stability screening using gel filtration chromatography to identify optimal buffer conditions. This technique requires as little as 10 μg of protein and takes less than 15 minutes to perform .

  • Buffer Optimization:
    For storage of purified YiaA, use:

    • Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • Add 50% glycerol for long-term storage

    • Store aliquots at -20°C/-80°C to avoid repeated freeze-thaw cycles

When reconstituting lyophilized protein, add deionized sterile water to a concentration of 0.1-1.0 mg/mL and aliquot with glycerol (final concentration 50%) for optimal stability .

How does YiaA function compare to its paralogous proteins in E. coli?

YiaA shares functional similarities with several paralogous proteins in E. coli, particularly YqjD, ElaB, and YgaM. Understanding these relationships provides insights into YiaA's potential functions:

Table 2: Comparison of YiaA and Its Paralogous Proteins

CharacteristicYiaAYqjDElaBYgaM
Size145 aa~100 aaSimilar to YqjDSimilar to YqjD
Expression TimingStationary phaseStationary phaseStationary phaseStationary phase
RegulationLikely RpoS-dependentRpoS-dependentSimilar to YqjDSimilar to YqjD
Transmembrane MotifC-terminal regionC-terminal region (residues 77-98)C-terminal region (residues 78-99)C-terminal region (residues 89-110)
Ribosome AssociationPredictedAssociates with 70S and 100S ribosomesSimilar to YqjDSimilar to YqjD
Effect of OverexpressionUnknownInhibits cell growthUnknownUnknown

Research with YqjD suggests that these proteins may play roles in:

  • Localizing ribosomes to the membrane during stationary phase

  • Regulating translation during stress conditions

  • Potentially inactivating ribosomes under specific growth conditions

Based on these similarities, experimental approaches designed for YqjD can be adapted for studying YiaA function, particularly focusing on its potential role in stress response and ribosome regulation during stationary phase.

How can I troubleshoot low yields when expressing recombinant YiaA protein?

When facing challenges with recombinant YiaA expression, consider these methodological approaches:

  • Signal Peptide Optimization:
    Low periplasmic yields may result from inefficient translocation. Test multiple signal peptides (DsbA, OmpA, PhoA, and Hbp) to identify the optimal combination for YiaA .

  • Production Rate Tuning:
    Research indicates that optimizing translational levels rather than maximizing them enhances membrane protein production. Create a library of translational initiation region (TIR) variants by modifying codons 2-6 of the signal peptide without changing the amino acid sequence .

  • Secretion Pathway Assessment:
    If using the Sec pathway, monitor for potential bottlenecks:

    • SecA levels (the motor protein of the Sec translocon)

    • LepB (signal peptidase)

    • YidC (insertase for membrane proteins)

    Proteomics analysis can identify if any of these components are limiting factors .

  • Strain Optimization:
    Consider evolutionary approaches to isolate improved production strains:

    • Chemical mutagenesis with MNNG (N-methyl-N'-nitro-N-nitrosoguanidine)

    • Tn5 transposon mutagenesis targeting components of secretion machinery

    • Screening for rrsE gene disruptions, which have shown improved membrane protein production

  • Alternative Secretion Systems:
    For difficult-to-express proteins, consider the Type I secretion system (T1SS), which can bypass periplasmic folding constraints. This approach requires fusion to the C-terminal domain of HlyA (50-60 amino acids) .

What statistical approaches are best for analyzing complex YiaA experimental data?

When analyzing data from YiaA experiments, especially those involving multiple variables and conditions, consider these advanced statistical approaches:

  • Controlling for Batch Effects:
    Use linear mixed models that include batch as a random effect to account for variability between experimental runs10 .

  • Addressing Potential Biases:
    Common biases in membrane protein studies include:

    Bias TypeDescriptionMitigation Strategy
    Healthy user biasBetter-expressing clones are selectedBalance clone selection; include randomly selected clones
    Ascertainment biasDifferential detection based on expression levelsUse consistent detection methods across all samples
    Immortal time biasOverlooking cells that died early due to toxicityPerform survival analysis; measure growth curves
  • Time Series Analysis:
    For stability studies extending over 72+ hours (similar to those performed with YidC-GFP), use:

    • Repeated measures ANOVA to analyze changes in expression over time

    • Flow cytometry to assess population heterogeneity and identify emergence of non-expressing subpopulations

    • Hierarchical clustering to identify patterns in expression profiles across time points

  • Factorial Analysis:
    When testing multiple factors affecting YiaA expression (e.g., temperature, media composition, induction timing), use factorial ANOVA to identify:

    • Main effects of each factor

    • Interaction effects between factors

    • Optimal combination of conditions

  • Variable Selection Methods:
    When analyzing proteomics data to identify proteins co-regulated with YiaA, use:

    • Principal Component Analysis (PCA) to reduce dimensionality

    • LASSO regression for identifying key predictors

    • Random Forest models for capturing non-linear relationships

What methods can be used to study the membrane topology and cellular localization of YiaA?

To investigate the membrane topology and localization of YiaA, researchers can employ the following methodological approaches:

  • Prediction and Computational Analysis:

    • Use the SOSUI system (http://bp.nuap.nagoya-u.ac.jp/sosui/) to predict transmembrane regions, which has successfully identified transmembrane motifs in the C-terminal region of similar proteins

    • Apply hydropathy plot analysis to identify potential membrane-spanning regions

    • Perform sequence alignment with known membrane proteins like YqjD to identify conserved topological features

  • Experimental Verification:

    • GFP Fusion Analysis: Create N- and C-terminal GFP fusions to determine protein orientation in the membrane

    • Cysteine Accessibility Method: Introduce cysteine residues at various positions and test their accessibility to membrane-impermeable thiol-reactive reagents

    • Protease Protection Assays: Determine which regions are protected from protease digestion in intact membrane vesicles

  • Subcellular Fractionation and Localization:

    • Separate cellular components through differential centrifugation as described for YqjD:

      • Suspend cells in TE buffer (50 mM Tris-HCl at pH 8.0, 5 mM EDTA) with protease inhibitors

      • Lyse with lysozyme

      • Remove debris by centrifugation (4,000 rpm, 5 min, 4°C)

      • Obtain membrane fraction by ultracentrifugation (50,000 rpm, 1.5 h, 4°C)

    • Analyze fractions using 2D-PAGE and mass spectrometry to confirm protein identity

  • Advanced Imaging Techniques:

    • Immunogold Electron Microscopy: Use antibodies against YiaA to visualize its precise localization at the ultrastructural level

    • Super-resolution Microscopy: Apply techniques like STORM or PALM to visualize YiaA distribution with nanometer precision

    • Live Cell Imaging: Create fluorescent protein fusions to monitor dynamic localization patterns during different growth phases

Understanding the membrane topology of YiaA is critical as its C-terminal transmembrane region may be functionally significant, similar to how YqjD's C-terminal region relates to its membrane binding function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.