Recombinant Inner membrane protein yibH (yibH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
yibH; Z5021; ECs4473; Inner membrane protein YibH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-378
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
yibH
Target Protein Sequence
MDLLIVLTYVALAWAVFKIFRIPVNQWTLATAALGGVFLVSGLILLMNYNHPYTFTAQKA VIAIPITPQVTGIVTEVTDKNNQLIQKGEVLFKLDPVRYQARVDRLQADLMTATHNIKTL RAQLTEAQANTTQVSAERDRLFKNYQRYLKGSQAAVNPFSERDIDDARQNFLAQDALVKG SVAEQAQIQSQLDSMVNGEQSQIVSLRAQLTEAKYNLEQTVIRAPSNGYVTQVLIRPGTY AAALPLRPVMVFIPEQKRQIVAQFRQNSLLRLKPGDDAEVVFNALPGQVFHGKLTSILPV VPGGSYQAQGVLQSLTVVPGTDGVLGTIELDPNDDIDALPDGIYAQVAVYSDHFSHVSVM RKVLLRMTSWMHYLYLDH
Uniprot No.

Target Background

Database Links

KEGG: ece:Z5021

STRING: 155864.Z5021

Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structural composition of recombinant YibH protein?

Recombinant Inner membrane protein YibH is a full-length (378 amino acids) protein from E. coli, identified by the UniProt ID P0AFV1. The protein is typically expressed with an N-terminal His tag to facilitate purification. Structurally, YibH contains multiple transmembrane domains that anchor it within the bacterial inner membrane. The amino acid sequence (MDLLIVLTYVALAWAVFKIFRIPVNQWTLATAALGGVFLVSGLILLMNYNHPYTFTAQKAVIAIPITPQVTGIVTEVTDKNNQLIQKGEVLFKLDPVRYQARVDRLQADLMTATHNIKTLRAQLTEAQANTTQVSAERDRLFKNYQRYLKGSQAAVNPFSERDIDDARQNFLAQDALVKGSVAEQAQIQSQLDSMVNGEQSQIVSLRAQLTEAKYNLEQTVIRAPSNGYVTQVLIRPGTYAAALPLRPVMVFIPEQKRQIVAQFRQNSLLRLKPGDDAEVVFNALPGQVFHGKLTSILPVVPGGSYQAQGVLQSLTVVPGTDGVLGTIELDPNDDIDALPDGIYAQVAVYSDHFSHVSVMRKVLLRMTSWMHYLYLDH) reveals characteristic membrane protein features including hydrophobic regions and transmembrane helices .

What expression systems are recommended for optimal YibH protein production?

E. coli is the primary expression system for recombinant YibH protein production due to the protein's bacterial origin. For optimal production, BL21(DE3) or C41(DE3) strains are recommended, particularly for membrane proteins. The expression vector should contain a strong inducible promoter (such as T7) and appropriate selection markers. For induction, IPTG concentrations between 0.1-0.5 mM typically yield optimal results, with expression conducted at lower temperatures (16-25°C) to enhance proper folding. The addition of suitable detergents during cell lysis and purification is essential for maintaining protein stability and solubility. To optimize expression, variables such as induction time, growth media composition, and cell density at induction should be systematically tested .

What purification strategies are most effective for His-tagged YibH?

Purification of His-tagged YibH requires a specialized approach for membrane proteins. The recommended protocol involves:

  • Cell lysis under native conditions using detergent-based buffers (common detergents include n-dodecyl-β-D-maltoside (DDM) or CHAPS at concentrations above their critical micelle concentration)

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size exclusion chromatography for final polishing

A typical purification workflow yields the following results:

Purification StepProtein Yield (mg/L culture)Purity (%)Recovery (%)
Crude Extract15-2510-20100
IMAC5-1080-9040-60
Size Exclusion3-8>9030-50

For optimal results, all buffers should contain 0.03-0.05% detergent and 10-15% glycerol to maintain protein stability. Purification should be performed at 4°C to minimize degradation .

How can YibH protein stability be optimized for structural studies?

Optimizing YibH stability for structural studies requires careful attention to buffer composition and storage conditions. The protein should be maintained in a buffer containing 20-50 mM Tris-HCl or phosphate buffer (pH 7.5-8.0), 150-300 mM NaCl, and 0.03-0.05% DDM or equivalent detergent. The addition of 6% trehalose significantly enhances stability during freeze-thaw cycles. For long-term storage, the protein should be flash-frozen in liquid nitrogen and stored at -80°C in small aliquots to avoid repeated freeze-thaw cycles. Prior to experimental use, centrifugation at 12,000×g for 10 minutes is recommended to remove any aggregates that may have formed during storage. Thermal stability assays indicate that YibH maintains >90% activity when stored at -80°C for up to 6 months under these conditions .

What methodologies are recommended for functional characterization of YibH?

Functional characterization of YibH involves multiple complementary approaches:

  • Ligand binding assays: Isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) to determine binding affinities with potential substrates

  • Transport assays: Reconstitution into liposomes followed by substrate uptake measurements using radiolabeled compounds or fluorescent probes

  • Structural analysis: Circular dichroism (CD) spectroscopy for secondary structure analysis and thermal stability determination

  • In vivo functional assays: Complementation studies in yibH knockout strains to assess functional recovery

When conducting these experiments, it's essential to include proper controls, such as denatured protein samples and known functional membrane proteins, to validate assay performance and specificity. The combination of these techniques provides a comprehensive functional profile of YibH and its interactions with potential substrates or binding partners .

How can researchers address detergent-related challenges when working with YibH?

Detergent selection is critical for successful experiments with membrane proteins like YibH. Researchers should implement a systematic detergent screening approach, testing multiple detergents such as DDM, LDAO, CHAPS, and octyl glucoside at various concentrations. For each detergent, evaluate protein stability using techniques such as size exclusion chromatography profiles, thermal shift assays, and activity measurements.

Common challenges and solutions include:

ChallengeMethodological SolutionSuccess Indicator
Protein aggregationIncrease detergent concentration; Add lipids (POPC/POPE) at 0.1-0.5 mg/mLMonodisperse peak on SEC
Low activityTest mixed micelles (combining two detergents)Increased substrate binding
Protein precipitationAdd glycerol (10-15%) or arginine (50-100 mM)Improved solution clarity
Detergent interference with assaysSwitch to nanodisc or SMALPs for detergent-free systemsElimination of background signal

During purification steps, maintaining detergent concentration above its critical micelle concentration (CMC) is crucial to prevent protein aggregation. For structural studies, smaller detergents with lower aggregation numbers often yield better results, while larger detergents may better preserve protein function .

What are the current approaches for studying YibH interactions with phages?

Studying YibH interactions with phages requires specialized methodologies that combine molecular biology and phage biology techniques. A comprehensive approach includes:

  • Phage susceptibility spot assays: Apply standardized phage suspensions (10⁶-10⁸ PFU/mL) to bacterial lawns expressing wild-type or mutant YibH, then quantify plaque formation and morphology

  • Growth kinetics assays: Monitor bacterial growth curves in the presence of phages to calculate inhibitory area under the curve (iAUC) values

  • Efficiency of plaque formation (EOP) assays: Determine the ratio of phage titers on test strains versus control strains

  • Co-evolution experiments: Culture bacteria with phages over multiple passages to identify evolutionary adaptations in both phage and bacterial populations

The most robust experimental design incorporates multiple independent biological replicates (n≥3) with appropriate statistical analysis to account for variability in phage-host interactions. These methods can reveal whether YibH serves as a phage receptor or contributes to phage resistance mechanisms .

How can CRISPR-Cas9 gene editing be utilized to study YibH function?

CRISPR-Cas9 gene editing offers precise approaches for studying YibH function through several strategic methodologies:

  • Complete gene knockout: Design sgRNAs targeting the yibH gene start codon region and middle region to ensure complete disruption

  • Domain-specific mutations: Create precise mutations in functional domains to identify critical residues for activity

  • Promoter modifications: Alter native promoter regions to study expression regulation

  • Tagged variant creation: Insert epitope or fluorescent tags for localization and interaction studies

When designing CRISPR experiments, researchers should:

  • Design multiple sgRNAs (3-4) per target to increase success probability

  • Include PAM site verification in E. coli genome

  • Incorporate HDR templates with 200-500bp homology arms for precise edits

  • Verify edits through both PCR screening and Sanger sequencing

Functional assessment of CRISPR-modified strains should include complementation with wild-type yibH to confirm phenotype specificity. This approach allows for precise correlation between genetic modifications and observed phenotypes .

What advanced structural biology techniques are suitable for characterizing YibH?

Characterizing the structure of membrane proteins like YibH requires specialized techniques beyond conventional approaches. Current advanced methods include:

  • Cryo-electron microscopy (Cryo-EM): Particularly single-particle analysis, which can achieve near-atomic resolution without crystallization. For YibH, reconstitution into nanodiscs prior to vitrification typically improves particle orientation distribution.

  • X-ray crystallography with lipidic cubic phase (LCP): This method provides a membrane-mimetic environment for crystallization, with typical conditions including monoolein as the host lipid, PEG 400 as precipitant, and additives such as cholesterol or specific lipids.

  • Solid-state NMR spectroscopy: Particularly useful for studying dynamic regions of YibH, requiring isotopic labeling (¹⁵N, ¹³C) during protein expression.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Valuable for mapping exposed regions and conformational changes upon substrate binding.

A comprehensive structural characterization typically combines multiple techniques. For example, a low-resolution Cryo-EM envelope can be refined using constraints from solid-state NMR and HDX-MS data. Recent developments in AlphaFold2 and RoseTTAFold also provide valuable in silico structural predictions that can guide experimental approaches .

How should researchers design experiments to investigate YibH's role in antimicrobial resistance?

Investigating YibH's potential role in antimicrobial resistance requires a multi-faceted experimental approach:

  • MIC determination: Perform standard agar dilution or broth microdilution assays following CLSI guidelines to determine minimum inhibitory concentrations of multiple antibiotic classes against wild-type and yibH-knockout strains

  • Expression analysis: Quantify yibH expression levels under antibiotic pressure using qRT-PCR or RNA-Seq analysis, with time-course studies to capture dynamic responses

  • Complementation studies: Reintroduce wild-type yibH and mutant variants into knockout strains to verify phenotype restoration

  • Transport assays: Measure accumulation of fluorescent antibiotics (e.g., fluoroquinolones) or radiolabeled compounds in cells with varying YibH expression levels

  • Resistance development: Conduct serial passage experiments in sub-MIC antibiotic concentrations to assess the rate of resistance development in presence and absence of functional YibH

For statistical validity, experiments should include at least three biological replicates with appropriate controls. When analyzing results, researchers should consider that membrane proteins may have pleiotropic effects, necessitating careful interpretation of phenotypic changes .

What are the methodological approaches for resolving contradictory results in YibH functional studies?

Resolving contradictory results in YibH functional studies requires systematic troubleshooting and experimental refinement:

  • Strain and construct verification: Confirm genetic background through whole-genome sequencing and verify expression constructs by sequencing. Ensure protein expression using Western blotting with anti-His antibodies.

  • Cross-laboratory validation: Implement standardized protocols across different laboratories using identical reagents, strains, and equipment settings.

  • Methodological triangulation: Apply multiple orthogonal techniques to study the same function:

Functional AspectPrimary MethodSecondary MethodTertiary Method
Substrate bindingITCFluorescence polarizationSPR
Membrane localizationFractionationImmunofluorescenceGFP fusion imaging
Transport activityRadioactive uptakeLiposome reconstitutionWhole-cell assays
  • Environmental variable control: Systematically test the impact of temperature, pH, ionic strength, and lipid composition on YibH function to identify condition-dependent behaviors.

  • Control protein inclusion: Include well-characterized membrane proteins as positive and negative controls in all experiments to validate assay performance.

When contradictory results persist despite these measures, consider that YibH might possess multiple functions or conformational states that are differentially captured by various experimental approaches .

How can researchers effectively study the impact of post-translational modifications on YibH function?

Studying post-translational modifications (PTMs) of YibH requires specialized approaches due to the challenges associated with membrane protein analysis:

  • PTM identification: Employ high-resolution mass spectrometry (LC-MS/MS) with multiple protease digestions to maximize sequence coverage. Special consideration should be given to sample preparation, using methods like filter-aided sample preparation (FASP) that are compatible with detergent removal.

  • Site-directed mutagenesis: Create alanine substitutions at putative modification sites to assess functional impact. For phosphorylation studies, phosphomimetic mutations (Ser/Thr to Asp/Glu) can be employed.

  • Modified protein enrichment: For specific PTMs, use enrichment strategies such as:

    • Phosphorylation: TiO₂ or immobilized metal affinity chromatography (IMAC)

    • Glycosylation: Lectin affinity chromatography

    • Ubiquitination: Antibody-based pulldowns

  • Temporal dynamics analysis: Implement pulse-chase experiments with stable isotope labeling to track PTM turnover rates.

  • In vivo validation: Develop specific antibodies against the modified form of YibH to confirm the presence and abundance of modifications under various growth conditions.

When analyzing PTM data, researchers should consider both the stoichiometry (percentage of protein modified) and the site occupancy (which specific sites are modified under different conditions) to fully understand the regulatory impact on YibH function .

What statistical approaches are recommended for analyzing YibH expression data?

Analyzing YibH expression data requires appropriate statistical methods based on the experimental design and data distribution:

  • For qRT-PCR data: Implement the ΔΔCt method with multiple reference genes (minimum 3) selected using geNorm or NormFinder algorithms. Statistical analysis should include:

    • Shapiro-Wilk test for normality

    • For normally distributed data: Student's t-test (two conditions) or ANOVA with post-hoc Tukey test (multiple conditions)

    • For non-normally distributed data: Mann-Whitney U test or Kruskal-Wallis with Dunn's post-hoc test

  • For RNA-Seq analysis: Use DESeq2 or edgeR packages with proper normalization for batch effects and technical variability. Multiple testing correction should be applied with Benjamini-Hochberg FDR method (q < 0.05).

  • For proteomics data: Implement MaxQuant for label-free quantification with at least 3 unique peptides per protein. Statistical analysis should use Perseus software with permutation-based FDR calculation.

  • Power analysis: Determine appropriate sample sizes before experiments using power calculations (typically aiming for 80% power with α = 0.05).

Data visualization should include both individual data points and error bars representing standard deviation or 95% confidence intervals. When presenting fold changes, log2 transformation is recommended to normalize the scale for up and down-regulation .

How should researchers integrate YibH structural and functional data to develop comprehensive models?

Integrating structural and functional data for YibH requires a systematic approach to develop comprehensive models:

  • Data layer integration:

    • Map functional data (e.g., binding constants, mutation effects) onto structural models

    • Correlate evolutionary conservation scores with structural elements

    • Integrate molecular dynamics simulations with experimental flexibility data

  • Computational modeling pipeline:

    • Start with homology modeling or AlphaFold2 prediction as baseline structure

    • Refine models using experimental constraints from Cryo-EM, SAXS, or crosslinking

    • Validate models through energy minimization and Ramachandran plot analysis

    • Identify functional domains through conservation mapping and pocket prediction

  • Functional annotation strategy:

    • Employ multi-sequence alignments with functionally characterized homologs

    • Use machine learning algorithms trained on membrane protein datasets to predict functional sites

    • Implement docking simulations with potential substrates to identify binding regions

  • Model validation approaches:

    • Design targeted mutations based on integrated model predictions

    • Measure functional impacts using activity assays

    • Iteratively refine models based on experimental feedback

This integrative approach produces testable hypotheses about structure-function relationships, enabling rational design of experiments to further characterize YibH. The final models should be deposited in appropriate databases with detailed methodology to ensure reproducibility .

What machine learning approaches can enhance YibH research data analysis?

Machine learning (ML) approaches can significantly enhance YibH research through various analytical applications:

  • Feature extraction from sequence data:

    • Recurrent Neural Networks (RNNs) for identifying functional motifs

    • Transformers (like ProtBERT) for capturing long-range sequence dependencies

    • Unsupervised learning for clustering YibH homologs into functional subfamilies

  • Structure prediction refinement:

    • Graph Neural Networks to model residue interactions beyond AlphaFold predictions

    • Reinforcement learning for optimizing membrane protein orientation in lipid bilayers

    • Variational autoencoders for generating alternative conformational states

  • Functional analysis enhancement:

    • Random forests for identifying critical residues from mutagenesis data

    • Convolutional neural networks for binding site prediction

    • Support vector machines for classifying substrate specificity

  • Experimental design optimization:

    • Bayesian optimization for identifying optimal buffer conditions

    • Active learning for guiding site-directed mutagenesis experiments

    • Transfer learning from related membrane proteins to predict YibH behavior

When implementing ML approaches, researchers should:

  • Ensure proper train/test splits (typically 80/20) with cross-validation

  • Address class imbalance using techniques like SMOTE or weighted loss functions

  • Interpret model predictions using tools like SHAP values or integrated gradients

  • Validate computational predictions with wet-lab experiments

These approaches collectively enhance the extraction of insights from complex, multi-dimensional YibH data, allowing researchers to discover patterns that might not be apparent through conventional analysis .

What emerging technologies show promise for advancing YibH research?

Several emerging technologies show particular promise for advancing YibH research in the coming years:

  • Cryo-electron tomography (Cryo-ET): Enables visualization of YibH in its native membrane environment without isolation, potentially revealing previously unobserved interactions and conformational states.

  • Single-molecule FRET (smFRET): Allows real-time monitoring of YibH conformational changes during substrate binding and transport, providing insights into the dynamic aspects of function.

  • Native mass spectrometry: Recent advances enable analysis of intact membrane protein complexes with preserved non-covalent interactions, helping identify transient binding partners.

  • Microfluidic platforms: Enable high-throughput screening of conditions for functional and structural studies while minimizing sample consumption.

  • Synthetic biology approaches: Designer cells with orthogonal translation systems allow incorporation of non-canonical amino acids for site-specific labeling and photocrosslinking.

  • AI-powered protein design: Computational tools can design YibH variants with enhanced stability or specific functions for biotechnological applications.

The integration of these technologies with existing approaches will likely overcome current technical limitations in membrane protein research, providing unprecedented insights into YibH structure, dynamics, and function. Researchers should consider forming interdisciplinary collaborations to effectively leverage these emerging methodologies .

How can systems biology approaches enhance understanding of YibH's role in cellular networks?

Systems biology approaches provide powerful frameworks for understanding YibH within broader cellular contexts:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data from wild-type and yibH knockout strains

    • Implement Bayesian network analysis to infer causal relationships

    • Use weighted gene correlation network analysis (WGCNA) to identify co-regulated gene modules

  • Flux balance analysis (FBA):

    • Develop genome-scale metabolic models incorporating YibH transport capabilities

    • Perform in silico knockouts to predict metabolic rewiring

    • Validate predictions with 13C metabolic flux analysis

  • Protein-protein interaction (PPI) mapping:

    • Employ BioID or APEX proximity labeling to identify interaction partners in the native membrane environment

    • Construct interaction networks using affinity purification-mass spectrometry (AP-MS)

    • Validate key interactions through co-immunoprecipitation and FRET

  • Pathway enrichment analysis:

    • Apply gene set enrichment analysis (GSEA) to identify pathways affected by YibH perturbation

    • Use pathway topology-based methods to account for the position of YibH in networks

    • Integrate with phenotypic data to establish functional relationships

This systems-level understanding reveals how YibH functions within the cellular context, potentially identifying unexpected roles in cellular processes beyond its currently known functions. The approach also highlights potential therapeutic targets in pathways that intersect with YibH function .

What are the challenges and opportunities in translating YibH research into therapeutic applications?

Translating YibH research into therapeutic applications presents both significant challenges and promising opportunities:

Challenges:

  • Membrane protein stability: YibH, like most membrane proteins, presents challenges in maintaining native conformation during isolation and formulation.

  • Specificity concerns: Targeting bacterial membrane proteins requires high selectivity to avoid cross-reactivity with human membrane proteins.

  • Delivery barriers: Designing delivery systems that can effectively target YibH in bacterial membranes, particularly in Gram-negative bacteria with their outer membrane barrier.

  • Resistance development: Potential for rapid emergence of resistance through mutations in yibH or compensatory pathways.

Opportunities:

  • Novel antibiotic target: If YibH proves essential for bacterial survival or virulence, it represents a previously unexploited target for antibiotic development.

  • Phage therapy enhancement: Understanding YibH-phage interactions could lead to engineered phages with enhanced targeting and efficacy.

  • Diagnostic applications: YibH-specific antibodies or aptamers could be developed for rapid bacterial detection.

  • Vaccine development: If YibH contains exposed epitopes, it could serve as an antigen for vaccine formulations.

Strategic approaches:

  • Structure-based drug design: Leverage high-resolution structures to identify druggable pockets and design specific inhibitors.

  • Fragment-based screening: Employ biophysical methods to identify small molecule fragments that bind to YibH.

  • Antibody-antibiotic conjugates: Develop antibodies targeting exposed regions of YibH as delivery vehicles for antibiotic payloads.

Successful translation will likely require interdisciplinary collaboration between structural biologists, medicinal chemists, immunologists, and clinical microbiologists to address these complex challenges .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.