Recombinant Inner membrane protein yidH (yidH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles should be avoided. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
For proper reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. To facilitate long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard protocol utilizes a 50% glycerol final concentration, which can be used as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the liquid form has a shelf life of 6 months at -20°C/-80°C. The lyophilized form maintains its quality for up to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The specific tag type will be determined during the manufacturing process.
Please inform us if you have a specific tag type requirement, and we will prioritize fulfilling your request during development.
Synonyms
yidH; SF3786; S3983; Inner membrane protein YidH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Shigella flexneri
Target Names
yidH
Target Protein Sequence
MKISRLGEAPDYRFSLANERTFLAWIRTALGFLAAGVGLDQLAPDFATPVIRELLALLLC LFSGGLAMYGYLRWLRNEKAMRLKEDLPYTNSLLIISLILMVVAVIVMGLVLYAG
Uniprot No.

Target Background

Database Links

KEGG: sfl:SF3786

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most efficient for recombinant yidH production?

Recombinant yidH is typically expressed in E. coli expression systems with an N-terminal His tag . For optimal expression, consider the following methodological approaches:

Expression ParameterRecommended ConditionRationale
Expression hostE. coli BL21(DE3)Reduced protease activity
Induction temperature18-25°CSlower expression improves membrane integration
Inducer concentration0.1-0.5 mM IPTGLower concentrations reduce protein aggregation
Expression time4-16 hoursExtended time improves yield for membrane proteins
Media supplements0.5-1% glucoseSuppresses leaky expression

These parameters should be systematically optimized through experimental design principles to maximize functional protein yield .

What are the optimal conditions for purifying yidH while maintaining its native structure?

Membrane proteins like yidH require careful handling during purification. Drawing from successful approaches with other membrane proteins like YidC, a rapid stability screening strategy based on gel filtration chromatography is recommended . This technique:

  • Requires minimal protein (approximately 10 μg)

  • Takes less than 15 minutes per condition

  • Allows efficient screening of multiple buffer compositions

  • Helps identify conditions that prevent aggregation

For yidH purification, consider this protocol sequence:

  • Membrane isolation using ultracentrifugation

  • Solubilization with mild detergents (DDM, LMNG, or C12E8)

  • IMAC purification utilizing the His-tag

  • Buffer screening to identify stabilizing conditions

  • Size exclusion chromatography as a final polishing step

How can I assess the quality and homogeneity of purified yidH?

Quality assessment of purified yidH should include:

Analysis MethodInformation ProvidedTechnical Considerations
SDS-PAGEPurity (>90% recommended)Use 12-15% gels for this small protein
Size exclusion chromatographyHomogeneity and aggregation stateMonitor A280/A260 ratio
Circular dichroismSecondary structure integrityScan 190-260 nm for membrane proteins
Dynamic light scatteringParticle size distributionUseful for detecting aggregation
Mass spectrometryExact mass and modificationsESI-MS most suitable for membrane proteins

What experimental designs are appropriate for studying yidH function?

When designing experiments to investigate yidH function, follow these systematic steps:

  • Define your variables clearly:

    • Independent variable: The parameter you manipulate (e.g., yidH expression levels)

    • Dependent variable: The outcome you measure (e.g., membrane integrity)

    • Control for extraneous variables such as growth conditions and strain background

  • Formulate a specific, testable hypothesis based on preliminary data or related protein functions

  • Design treatments that specifically manipulate your independent variable

  • Establish appropriate control groups to isolate the effect of your variable of interest

  • Implement rigorous measurement protocols for your dependent variable

This approach ensures systematic investigation of yidH function while minimizing experimental bias and confounding factors.

How can I investigate potential interactions between yidH and other membrane proteins?

Based on methodologies used for studying related membrane proteins like YidC and YidD, consider these approaches:

  • In vivo crosslinking using photo-activatable or chemical crosslinkers to capture transient interactions

  • Co-immunoprecipitation studies with epitope-tagged yidH

  • Bacterial two-hybrid systems modified for membrane protein interactions

  • Proximity-based labeling approaches (BioID or APEX)

  • Genetic interaction studies using synthetic lethality screening

For example, YidD was found to be in proximity to nascent inner membrane proteins during their localization in the Sec-YidC translocon using in vitro cross-linking, suggesting a similar approach might reveal yidH interaction partners .

How might yidH relate to membrane protein insertion machinery in bacteria?

While direct evidence for yidH's role in protein insertion is limited, research on the related protein YidD provides a methodological framework. YidD, which is part of the same gene cluster as YidC, affects the insertion and processing of YidC-dependent inner membrane proteins .

To investigate whether yidH plays a similar role:

  • Generate a ΔyidH strain using lambda red recombination

  • Compare insertion efficiency of model membrane proteins between wild-type and ΔyidH strains

  • Perform pulse-chase experiments to track membrane protein maturation

  • Use in vitro translation/translocation assays with purified components

  • Employ site-specific crosslinking to detect proximity to nascent chains

What structural biology approaches are most promising for yidH characterization?

For structural characterization of small membrane proteins like yidH (115 aa), consider these methodologies:

Structural MethodAdvantagesTechnical Considerations
X-ray crystallographyHigh resolution potentialRequires stable, homogeneous protein and suitable crystals
Cryo-electron microscopyNo crystallization neededChallenging for small membrane proteins; consider fusion partners
NMR spectroscopyGood for dynamic regionsRequires isotope labeling; limited by size
Molecular dynamics simulationPredicts dynamicsRequires experimental validation
AlphaFold or RoseTTAFoldPredictive modelingAccuracy may vary for membrane proteins

Successful structural studies require highly purified protein that can be concentrated without aggregation and remains stable for weeks at 4°C .

How can I systematically study the effect of mutations on yidH structure and function?

A comprehensive mutagenesis strategy might include:

  • Alanine-scanning mutagenesis of conserved residues

  • Site-directed mutagenesis targeting charged residues within transmembrane regions

  • Introduction of reporter groups (cysteine residues for labeling or crosslinking)

  • Construction of chimeric proteins to identify functional domains

  • Truncation analysis to determine minimal functional units

For each mutant, assess:

  • Expression levels and membrane integration

  • Protein stability using thermal shift assays

  • Functional impact through complementation studies

  • Structural changes via circular dichroism or fluorescence spectroscopy

How does yidH compare to other bacterial inner membrane proteins in the same gene cluster?

While yidH is distinct from YidC and YidD, examining their functional relationships can be informative. YidC is an essential component in membrane protein insertion and assembly, while YidD is involved in efficient insertion of YidC-dependent inner membrane proteins .

To investigate potential functional relationships:

  • Perform comparative sequence analysis across bacterial species

  • Examine gene expression patterns under various conditions

  • Construct double mutants (e.g., ΔyidDΔyidH) to identify genetic interactions

  • Compare biochemical properties and interaction networks

  • Analyze evolutionary conservation patterns

What can be learned from applying techniques used for YidC purification to yidH studies?

The successful purification strategy developed for YidC provides valuable insights for yidH work. This approach yielded several milligrams of purified YidC that remained stable for weeks at +4°C and could be concentrated to levels suitable for structural studies .

Key transferable elements include:

  • Rapid buffer screening to identify stabilizing conditions

  • Optimization of detergent type and concentration

  • Addition of lipids or lipid-like molecules during purification

  • Temperature management throughout the purification process

  • Use of glycerol or similar additives to enhance stability

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.