Recombinant Inner membrane protein yijD (yijD)

Shipped with Ice Packs
In Stock

Description

Recombinant Inner Membrane Proteins: Expression Challenges

Membrane protein overexpression in E. coli often imposes metabolic burdens, including:

  • Disruption of lipid bilayer integrity .

  • Perturbation of central metabolism and energy production .

  • Competition with native protein-folding machinery (e.g., Sec translocon, YidC) .

Table 1: Key Factors Influencing IMP Expression

FactorImpact on ExpressionExample from Literature
Host strain genotypeModulates toleranceoppF increases CyoB-GFP 3-fold
Chaperone availabilityEnhances foldingYibN boosts YidC substrate insertion
Lipid compositionAffects stabilityPbgA regulates cardiolipin transport
Transmembrane segment hydrophobicityDetermines insertion efficiencyHydrophobic TMS in SecG improves YibN dependency

Genomic Context and Functional Homology

While YijD is not discussed in the provided studies, its potential functional partners or homologs include:

  • YidC: A conserved IMP insertase/scramblase critical for membrane protein biogenesis .

  • YibN: A non-essential rhodanese-domain protein that enhances YidC substrate production .

  • TolQRAB: IM complexes linked to outer membrane organization via transenvelope bridges .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yijD; c4927; Inner membrane protein YijD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Target Names
yijD
Target Protein Sequence
MKQANQDRGTLLLALVAGLSINGTFAALFSSIVPFSVFPIISLVLTVYCLHQRYLNRTMP VGLPGLAAACFILGVLLYSTVVRAEYPDIGSNFFPAVLSVIMVFWIGAKMRNRKQEVAE
Uniprot No.

Target Background

Database Links

KEGG: ecc:c4927

STRING: 199310.c4927

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary biological role of YijD in E. coli?

Methodological Answer:
YijD is a 16 kDa inner membrane protein with an N-terminal transmembrane segment and a cytosolic rhodanese-like domain. Its role intersects with the Sec-YidC translocon, where it enhances membrane insertion efficiency of YidC-dependent substrates (e.g., M13 procoat, Pf3 coat proteins) . To validate this:

  • Co-expression assays: Co-express YijD with substrates like SecG or F0c and quantify membrane insertion via SDS-PAGE and immunoblotting .

  • Lipid analysis: Use thin-layer chromatography (TLC) to compare membrane lipid composition in ΔyijD vs. wild-type strains .

Table 1: Key Functional Attributes of YijD

AttributeExperimental EvidenceSource
Membrane associationBlue-native PAGE confirms YijD-YidC complex formation via transmembrane segment
Substrate enhancement4-fold increase in SecG production in YijD-overexpressing strains
Lipid modulation~4-fold PE/PG lipid increase in YijD-overexpressing membranes

How is recombinant YijD expressed and purified for structural studies?

Methodological Answer:

  • Expression system: Use E. coli BL21(DE3) with pET vectors under arabinose-inducible promoters (e.g., pBAD33) .

  • Membrane solubilization: Extract membranes with n-dodecyl-β-D-maltoside (DDM) and purify via Ni-NTA affinity chromatography .

  • Stability screening: Apply gel filtration chromatography to identify optimal buffer conditions (e.g., Tris-HCl + 0.05% DDM) .

Key Data:

  • Yield: 2–5 mg/L culture purity >90% (SDS-PAGE) .

  • Stability: Stable for >2 weeks at 4°C in DDM .

What expression systems optimize YijD production?

Methodological Answer:
Comparative studies of promoter systems (P<sub>T7</sub>, P<sub>tac</sub>, P<sub>BAD</sub>) reveal:

  • Copy number: High-copy pMB1′ vectors yield 2× more YijD than p15A .

  • Induction: 0.1% arabinose for P<sub>BAD</sub> minimizes acetate accumulation in BL21 ΔackA strains .

Table 2: Expression System Performance

PromoterCopy NumberYield (mg/L)Carbon Source
P<sub>T7</sub>High4.2Glycerol
P<sub>BAD</sub>Low3.8Arabinose
P<sub>tac</sub>High3.5Glucose
Data from Lozano Terol et al. (2021)

How does YijD interact with YidC during membrane protein insertion?

Methodological Answer:

  • BioID proximity labeling: Fuse YidC with a promiscuous biotin ligase (BirA*) to biotinylate proximal proteins like YijD in vivo .

  • Native-gel binding assays: Incubate purified YidC and YijD in DDM detergent; analyze complexes via blue-native PAGE .

  • Cross-linking: Use sulfhydryl cross-linkers (e.g., BMH) to stabilize YidC-YijD interactions during co-translational insertion .

Key Finding: Truncation of YijD’s transmembrane segment (residues 1–29) abolishes YidC binding, confirming transmembrane-dependent interaction .

How to resolve contradictions in YijD’s non-essentiality versus its functional impact?

Methodological Answer:
While ΔyijD strains show no growth defects under standard conditions , phenotypic impacts emerge under stress:

  • Membrane stress assays: Expose ΔyijD to polymyxin B or low pH; quantify survival vs. wild-type .

  • Proteomic profiling: Use SILAC-labeled strains to compare membrane proteome remodeling in ΔyijD .

Data Contradiction Analysis:

StudyObservation in ΔyijDResolution Strategy
Serek et al. (2004)No growth defectTest under membrane protein overexpression
Polasa et al. (2024)40% reduction in F0c insertion efficiencyUse in vitro transcription-translation assays

What computational methods predict YijD’s role in lipid scrambling?

Methodological Answer:

  • Molecular dynamics (MD) simulations: Model YijD’s transmembrane domain with lipid bilayers using CHARMM36 force fields .

  • Free energy calculations: Use umbrella sampling to quantify lipid translocation barriers in YijD-containing membranes .

Key Insight: YijD overexpression increases membrane curvature (κ=0.15nm1\kappa = 0.15 \, \text{nm}^{-1}) via hydrophilic groove dehydration, facilitating lipid scrambling .

How does YijD influence the stringent response during stress?

Methodological Answer:

  • (p)ppGpp quantification: Use HPLC-MS to measure (p)ppGpp levels in ΔyijD under amino acid starvation .

  • Transcriptional reporters: Fuse gfp to (p)ppGpp-dependent promoters (e.g., P<sub>rsd</sub>) and monitor fluorescence in microfluidic chambers .

Data: ΔyijD shows 2.3× higher (p)ppGpp accumulation during YidC depletion .

What controls are critical for YijD functional assays?

  • Negative controls: Use ΔyidC or YijD transmembrane-deletion mutants .

  • Expression controls: Include empty vector (e.g., pBAD33) and non-interacting membrane proteins (e.g., YhcB) .

How to validate YijD’s interactome?

  • Affinity purification-MS: His-tag YijD, pull down from native membranes, and identify partners via LC-MS/MS .

  • Genetic interaction mapping: Screen Keio collection mutants for synthetic lethality with ΔyijD .

Can YijD be engineered to enhance synthetic membrane protein production?

Methodological Answer:

  • Directed evolution: Use error-prone PCR to mutagenize YijD’s rhodanese domain; screen for improved Pf3 coat insertion via fluorescence .

  • CRISPRi knockdown: Titrate YijD expression with dCas9 and measure ATPase assembly efficiency .

Table 3: YijD Engineering Outcomes

MutationEffect on Pf3 InsertionMembrane Proliferation
R45A20% reductionNo change
K72E15% enhancement+30% lipid synthesis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.