Recombinant Inner membrane protein yjcH (yjcH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yjcH; SF4128; S3595; Inner membrane protein YjcH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Shigella flexneri
Target Names
yjcH
Target Protein Sequence
MNGTIYQRIEDNAHFRELVEKRQRFATILSIIMLAVYIGFILLIAFAPGWLGTPLNPNTS VTRGIPIGVGVIVISFVLTGIYIWRANGEFDRLNNEVLHEVQAS
Uniprot No.

Target Background

Database Links

KEGG: sfl:SF4128

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the yjcH inner membrane protein and what is its localization in bacterial cells?

The yjcH protein is an integral inner membrane protein found in several bacterial species, including Escherichia coli and Shigella flexneri. Like other inner membrane proteins such as YhcB, yjcH is embedded within the cytoplasmic membrane with specific topology that determines its functional characteristics. Inner membrane proteins typically contain multiple transmembrane domains that anchor them within the lipid bilayer . The localization of yjcH to the inner membrane suggests potential roles in processes such as cell envelope maintenance, transport functions, or signal transduction. Experimental verification of localization can be performed using membrane fractionation techniques followed by Western blotting or through fluorescence microscopy with tagged variants of the protein.

What experimental approaches should be used to determine the function of yjcH?

Determining the function of inner membrane proteins like yjcH requires a multi-faceted approach:

  • Genetic Analysis: Create deletion mutants (ΔyjcH) and screen for phenotypes under various growth conditions.

  • Synthetic Lethality Screening: Identify genes that, when deleted in combination with yjcH, result in cellular inviability, similar to the synthetic lethality observed between yhcB and rodZ .

  • Protein-Protein Interaction Studies: Employ bacterial two-hybrid systems to identify interaction partners .

  • Physiological Assays: Examine effects on membrane integrity, cell shape, and response to environmental stressors.

  • Complementation Studies: Test whether yjcH can functionally replace other membrane proteins in heterologous systems.

Such comprehensive analysis can provide insights into the biological role of yjcH, as demonstrated by similar approaches with YhcB, which revealed connections to cell shape maintenance through interaction with RodZ .

What expression systems are optimal for recombinant yjcH production?

For recombinant inner membrane protein expression, consider the following systems:

Expression SystemAdvantagesDisadvantagesBest For
E. coli BL21(DE3)High yield, easy manipulationPotential toxicity, inclusion body formationInitial screening
E. coli C41/C43Designed for membrane proteinsLower yields than BL21Difficult-to-express proteins
Cell-free systemsAvoids toxicity issuesExpensive, lower yieldsHighly toxic proteins
Yeast expressionBetter folding of complex proteinsMore complex protocolsProteins requiring eukaryotic processing

For optimal expression of inner membrane proteins like yjcH in E. coli, key parameters include using lower temperatures (25°C), reduced inducer concentrations (0.1 mM IPTG), and growth to moderate cell density (OD600 of 0.8) before induction . These conditions have been shown to improve the soluble expression of recombinant proteins while reducing inclusion body formation.

How can experimental design approaches be optimized for expression of inner membrane proteins like yjcH?

Optimizing expression of membrane proteins requires systematic evaluation of multiple variables. Based on successful approaches for other recombinant proteins, a factorial design experiment is recommended:

  • Variables to consider:

    • Induction temperature (18°C, 25°C, 30°C, 37°C)

    • Inducer concentration (0.01 mM, 0.1 mM, 0.5 mM, 1 mM IPTG)

    • Growth phase at induction (early log, mid-log, late log)

    • Media composition (standard LB, enriched media, minimal media)

    • Induction time (2h, 4h, 6h, overnight)

    • Presence of specific additives (glycerol, sorbitol, betaine)

  • Statistical approach: Implement a fractional factorial design (2^8-4) to reduce experimental burden while maintaining statistical power to identify significant effects .

  • Response measurement: Evaluate protein yield and quality through activity assays or structural integrity measurements specific to yjcH function.

This multivariate approach has been demonstrated to be superior to traditional one-factor-at-a-time optimization, providing higher-quality information with fewer experiments .

What techniques are most informative for structural characterization of inner membrane proteins like yjcH?

The structural characterization of inner membrane proteins presents unique challenges due to their hydrophobic nature. A complementary set of techniques is recommended:

  • X-ray Crystallography: Requires detergent solubilization and crystallization, challenging but provides atomic-level resolution.

  • Cryo-Electron Microscopy: Increasingly powerful for membrane protein structures, especially in lipid nanodiscs.

  • NMR Spectroscopy: Useful for dynamics studies and smaller membrane proteins or domains.

  • Topology Mapping: Using reporter fusions (PhoA, GFP) to determine transmembrane organization.

  • Cross-linking Studies: To identify proximity relationships between domains or interaction partners.

  • Molecular Dynamics Simulations: Computational approach to understand protein behavior in the membrane environment.

For inner membrane proteins similar to yjcH, combining topology mapping with targeted mutagenesis has proven particularly informative for understanding structure-function relationships, as demonstrated with the YhcB protein investigations .

How does membrane environment affect the stability and function of recombinant yjcH?

The lipid environment critically influences inner membrane protein stability and function:

  • Lipid composition effects: Phospholipid headgroups and acyl chain lengths modulate protein conformation and activity.

  • Detergent selection for purification:

    • Harsh detergents (SDS, CTAB) typically denature membrane proteins

    • Mild detergents (DDM, LMNG, CHAPS) better preserve native structure

    • Detergent screening is essential for each specific membrane protein

  • Reconstitution strategies:

    • Proteoliposomes provide a controlled lipid environment

    • Nanodiscs maintain a native-like bilayer while providing sample homogeneity

    • Amphipols offer stability without free detergent

  • Membrane tension and curvature: Physical properties of the membrane can affect protein conformation and oligomerization state.

Studies with other inner membrane proteins such as components of the SecYEG–SecDF–YajC–YidC holotranslocon have demonstrated that proper lipid environment is essential for maintaining native functional states .

What methods are most effective for studying protein-protein interactions of inner membrane proteins like yjcH?

Several complementary approaches should be considered:

  • Bacterial Two-Hybrid (B2H) Systems: Particularly valuable for initial screening of potential interaction partners. The Y2H-SCORES computational framework provides statistical methods to analyze B2H data, calculating enrichment, specificity, and in-frame scores to identify high-confidence interactors .

  • Co-immunoprecipitation (Co-IP): Using epitope-tagged versions of yjcH to pull down interaction partners from solubilized membranes.

  • Förster Resonance Energy Transfer (FRET): For examining interactions in the native membrane environment.

  • Surface Plasmon Resonance (SPR): To determine binding kinetics between purified components.

  • Chemical Cross-linking Combined with Mass Spectrometry: Identifies interaction interfaces and transient interactions.

For inner membrane proteins, B2H has proven particularly useful, as demonstrated by its application to identify the interaction between YhcB and RodZ in E. coli . The Y2H-SCORES approach provides robust statistical methods to rank interaction candidates, with demonstrated ROC Area Under the Curve values of 0.98-1.0 for its scoring metrics .

How can genetic approaches supplement biochemical methods in identifying functional interactions of yjcH?

Genetic approaches provide powerful complementary evidence for functional interactions:

  • Synthetic Lethality Screening: Systematic examination of double mutants to identify genes that become essential in the absence of yjcH. This approach revealed the functional relationship between yhcB and rodZ .

  • Suppressor Mutation Analysis: Identifying mutations that restore function in yjcH mutant backgrounds.

  • Genetic Interaction Mapping: Using transposon sequencing (Tn-seq) or synthetic genetic arrays to systematically map genetic interactions.

  • Multicopy Suppression: Testing whether overexpression of candidate genes can compensate for yjcH deletion.

  • Site-Directed Mutagenesis: Creating point mutations in conserved residues to identify functionally important domains.

The combination of genetic and biochemical approaches provides more robust evidence for genuine functional interactions than either approach alone.

How do inner membrane proteins like yjcH respond to environmental stressors such as pH changes?

Inner membrane proteins often play crucial roles in bacterial adaptation to environmental stress. Ribosome profiling and RNA sequencing have revealed that bacteria like E. coli exhibit fine-tuned responses to different degrees of acidity, involving regulated expression of membrane proteins .

For studying yjcH's response to pH stress:

  • Transcriptional response: Quantify yjcH mRNA levels under various pH conditions using qRT-PCR or RNA-seq.

  • Translational efficiency: Apply ribosome profiling to assess translation rates of yjcH under stress conditions, similar to approaches that have uncovered stress-induced small protein synthesis in E. coli .

  • Protein stability and localization: Examine whether acidic conditions affect yjcH stability or membrane localization.

  • Functional assays: Determine if yjcH's biochemical activities are pH-dependent.

  • Mutant phenotyping: Compare wild-type and ΔyjcH strains for survival and growth under various pH conditions.

What role might yjcH play in bacterial pathogenesis or antimicrobial resistance?

Inner membrane proteins can contribute to bacterial pathogenesis and antimicrobial resistance through several mechanisms:

  • Envelope integrity: Like YhcB, which interacts with RodZ in cell shape maintenance , yjcH may contribute to cell envelope integrity under host-associated stresses.

  • Efflux pump association: Some inner membrane proteins function as components of multidrug efflux systems.

  • Stress response pathways: Membrane proteins often participate in sensing and responding to host-associated stresses.

  • Secretion system components: Inner membrane proteins can be critical components of secretion machinery for virulence factors.

  • Biofilm formation: Similar to YhcB, whose deletion reduces biofilm formation , yjcH may influence bacterial community behaviors relevant to pathogenesis.

Research approaches should include comparative genomics across pathogenic and non-pathogenic strains, phenotypic characterization under infection-relevant conditions, and potential roles in antibiotic susceptibility through minimum inhibitory concentration testing of yjcH mutants.

How can ribosome profiling be used to understand the translation dynamics of inner membrane proteins like yjcH?

Ribosome profiling offers unprecedented insights into translation dynamics of membrane proteins:

  • Experimental approach:

    • Flash-freeze bacterial cultures to capture translation in progress

    • Perform cryogenic grinding to avoid translation-arresting drugs

    • Isolate monosomes and prepare ribosome-protected fragments (RPFs)

    • Create sequencing libraries from RPFs and total RNA

    • Analyze using bioinformatics pipelines like HRIBO

  • Key insights obtainable:

    • Translation efficiency across different conditions

    • Codon-specific translation rates that may affect membrane protein folding

    • Potential translational pausing sites that could be critical for proper membrane insertion

    • Identification of novel open reading frames or small proteins within operons

  • Limitations and considerations:

    • Requires careful optimization to avoid rRNA contamination

    • Cell lysis methods must be optimized for membrane proteins

    • Data analysis requires specialized bioinformatic approaches

Such approaches have successfully revealed novel adaptations to stress conditions in E. coli, including previously hidden stress-induced small proteins .

What computational approaches can predict structure-function relationships in yjcH?

Modern computational methods offer valuable insights into membrane protein structure and function:

  • Homology modeling: Using structures of related proteins as templates.

  • Ab initio structure prediction: Tools like AlphaFold2 and RoseTTAFold have demonstrated breakthrough capabilities for predicting membrane protein structures.

  • Molecular dynamics simulations: Provide insights into protein behavior within the membrane environment.

  • Evolutionary coupling analysis: Identifies co-evolving residues that may indicate functional interactions or structural constraints.

  • Site-directed mutation prediction: Computational tools can predict the impact of mutations on stability and function.

  • Protein-protein docking: Predicts potential interaction interfaces with partner proteins.

These computational approaches should be used iteratively with experimental validation to develop and refine hypotheses about yjcH structure and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.