Recombinant Inner membrane protein ylaC (ylaC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
ylaC; SF0403; S0410; Inner membrane protein YlaC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Shigella flexneri
Target Names
ylaC
Target Protein Sequence
MTEIQRLLTETIESLNTREKRDNKPRFSISFIRKHPGLFIGMYVAFFATLAVMLQSETLS GSVWLLVVLFILLNGFFFFDVYPRYRYEDIDVLDFRVCYNGEWYNTRFVPAALVEAILNS PRVADVHKEQLQKMIVRKGELSFYDIFTLARAESTS
Uniprot No.

Target Background

Database Links

KEGG: sfl:SF0403

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ylaC and what is its biological function in Bacillus subtilis?

YlaC functions as an extracytoplasmic function (ECF) sigma factor in Bacillus subtilis that plays a crucial role in regulating gene expression during oxidative stress and sporulation initiation. YlaC interacts with YlaD, a membrane-anchored anti-sigma factor containing a redox-sensing HX3CXXC motif. Research has demonstrated that YlaC autoregulates the P* promoter and controls the expression of important genes including clpP and sigH, which are essential for sporulation processes .

Methodological approach: To investigate ylaC function, researchers should employ gene knockout studies combined with transcriptome analysis. Reporter gene constructs using P*::ylaC-gusA fusions can effectively monitor YlaC-dependent transcriptional activity under various environmental conditions .

How does the YlaC-YlaD regulatory system respond to oxidative stress?

The YlaC-YlaD system represents a sophisticated redox-sensing regulatory mechanism. Under normal conditions, YlaD binds to YlaC, inhibiting its transcriptional activity. When cells encounter oxidative stress, YlaD undergoes conformational changes that trigger its dissociation from YlaC, allowing YlaC to activate transcription of target genes .

Experimental evidence has shown that reduced YlaD contains zinc and iron metals, while oxidized YlaD does not contain these metals. The HX3CXXC motif in YlaD is essential for this redox sensing, with Cys3 playing a particularly critical structural role. Mutation of this cysteine causes dissociation from YlaC, indicating the importance of this motif for maintaining the inhibitory interaction .

Methodological approach: Researchers should utilize protein-protein interaction assays such as bacterial two-hybrid systems, co-immunoprecipitation, or surface plasmon resonance under controlled redox conditions to characterize this interaction.

What expression systems are most appropriate for recombinant ylaC production?

For recombinant expression of membrane proteins like ylaC, researchers should consider several expression systems, each with distinct advantages:

  • E. coli expression system: While cost-effective and rapid, E. coli has limitations for membrane proteins but has been used successfully for 4 of 62 recombinantly expressed eukaryotic membrane proteins with known structures .

  • Yeast expression systems: Both Pichia pastoris and Saccharomyces cerevisiae provide eukaryotic environments with post-translational modification capabilities, accounting for 20 of 62 successfully expressed eukaryotic membrane proteins with determined structures .

  • Insect cell expression system: This baculovirus-infected system has proven particularly successful for membrane proteins, with 35 of 62 structurally characterized eukaryotic membrane proteins being produced this way .

  • Mammalian cell expression system: Though more complex and expensive, this provides the most native environment for mammalian proteins .

Methodological approach: Initial expression trials should test multiple systems in parallel. Fluorescence-detected size exclusion chromatography (FSEC) using GFP-tagged constructs allows rapid assessment of expression, stability, and monodispersity without complete purification .

What experimental design principles should be applied when studying ylaC function?

When designing experiments to study ylaC function, researchers should follow these key principles:

  • Hypothesis formulation: Establish clear, testable hypotheses about ylaC function based on existing knowledge of ECF sigma factors and the YlaC-YlaD interaction .

  • Variable definition: Clearly define independent variables (e.g., oxidative stress conditions, manganese concentrations), dependent variables (e.g., transcriptional activity, protein-protein interactions), and control for extraneous factors .

  • Control groups: Include appropriate controls such as ylaC knockout strains, point mutants with altered function, and wild-type comparisons .

  • Replication: Ensure sufficient biological and technical replicates to establish statistical significance .

  • Measurement precision: Use quantitative assays for ylaC activity such as reporter gene expression, RT-qPCR for target gene expression, or direct measurement of protein-protein interactions .

Methodological approach: A well-designed experimental approach should incorporate multiple complementary techniques to establish causality between ylaC activity and observed phenotypes, rather than merely correlative relationships .

What molecular mechanisms underlie the YlaC-YlaD interaction under different redox conditions?

The molecular mechanisms governing the YlaC-YlaD interaction involve sophisticated redox sensing through the HX3CXXC motif in YlaD. Research has demonstrated that:

  • Under reducing conditions, YlaD contains zinc and iron, which maintain a conformation that allows binding to YlaC, inhibiting its transcriptional activity .

  • Under oxidative conditions, YlaD loses these metals, undergoing conformational changes that disrupt its interaction with YlaC .

  • Far-UV circular dichroism (CD) spectrum analysis reveals that cysteine substitutions in YlaD lead to significant changes in its secondary structure .

  • Cys3 in the HX3CXXC motif plays a particularly crucial structural role, as its mutation causes dissociation from YlaC even under non-oxidative conditions .

Methodological approach: To elucidate these mechanisms, researchers should employ site-directed mutagenesis of individual cysteine residues in the HX3CXXC motif, combined with structural analysis techniques like X-ray crystallography or cryo-electron microscopy. Hydrogen-deuterium exchange mass spectrometry can identify conformational changes under different redox states.

How do metal ions influence the structural integrity and function of the YlaC-YlaD system?

Metal ions play a critical role in the YlaC-YlaD regulatory system, with experimental evidence showing:

  • Reduced YlaD contains zinc and iron, while oxidized YlaD lacks these metals .

  • Addition of manganese (Mn) ions to zinc-bound YlaD (Zn-YlaD) alters its secondary structure, as demonstrated by far-UV CD spectrum analysis .

  • When Mn ions are added to Zn-YlaD, iron in the protein is substituted with manganese, indicating a metal exchange mechanism with potential physiological significance .

  • The YlaD-mediated transcriptional activity of YlaC regulates sporulation initiation under both oxidative stress and Mn-substituted conditions through regulation of clpP gene transcripts .

This data reveals a complex regulatory system where both redox state and metal availability act as environmental signals that modulate YlaD conformation and its interaction with YlaC.

Methodological approach: Researchers should analyze metal content using inductively coupled plasma mass spectrometry (ICP-MS), perform metal substitution experiments with purified proteins, and conduct functional assays measuring YlaC activity in response to different metal ions and chelating agents.

How does ylaC regulate sporulation genes under different environmental conditions?

The YlaC-YlaD system functions as a sophisticated molecular switch regulating sporulation in response to environmental signals:

  • YlaC expression is observed specifically during late-exponential and early-stationary phase, as measured by βGlu activity from the P*::ylaC-gusA reporter construct .

  • YlaC-overexpressing mutants constitutively express gene transcripts of clpP and sigH, an important alternative σ factor regulated by ClpXP .

  • SigH is known to be critical for early sporulation gene expression, establishing a direct link between YlaC activity and sporulation initiation .

  • The YlaC-YlaD system responds to both oxidative stress and changes in manganese concentration, integrating these environmental signals into the sporulation decision pathway .

Methodological approach: Researchers should utilize RNA-seq or microarray analysis comparing wild-type and ylaC mutant strains across growth phases, ChIP-seq to identify direct YlaC binding sites, and reporter fusions for target genes. Combining these approaches with specific stress conditions provides a comprehensive picture of condition-specific regulation.

How can artificial chromosome systems be adapted for efficient expression of ylaC?

Based on artificial chromosome technologies like the ylAC system developed for Yarrowia lipolytica, similar principles could be applied for efficient ylaC expression:

  • Design elements: The artificial chromosome should incorporate:

    • Origin of replication (ARS) for autonomous replication

    • Centromeric sequences (CEN) for proper segregation

    • Telomeric sequences (TEL) for chromosome stability if linear configuration is desired

    • Appropriate selection markers

  • Construction strategy: In vivo assembly methods have demonstrated high efficiency (>90% success rate) for constructing complex gene assemblies in artificial chromosomes .

  • Expression configuration: The artificial chromosome can accommodate the entire ylaC-ylaD operon with native regulatory elements or modified versions for specific experimental purposes .

  • Stability considerations: Research shows that artificial chromosomes can be genetically maintained over multiple generations either under selective conditions or using essential genes as selection markers .

Methodological approach: When adapting artificial chromosome systems for ylaC expression, researchers should optimize promoter strength, incorporate appropriate secretion signals for membrane localization, and include reporter genes to monitor expression levels and localization.

What approaches can be used to determine the three-dimensional structure of ylaC?

Determining the structure of membrane proteins like ylaC presents unique challenges requiring specialized approaches:

  • Expression optimization: Screen multiple expression systems (E. coli, yeast, insect cells, mammalian cells) to identify conditions yielding the highest amount of properly folded protein .

  • Purification strategy:

    • Solubilize membranes using detergents that maintain native protein structure

    • Implement affinity chromatography followed by size exclusion chromatography

    • Monitor protein homogeneity using dynamic light scattering and analytical ultracentrifugation

  • Crystallization techniques:

    • Test various crystallization methods including vapor diffusion, lipidic cubic phase, and bicelle methods

    • Screen multiple detergents, additives, and precipitants

    • Consider co-crystallization with binding partners (e.g., YlaD) or antibody fragments

  • Alternative structural methods:

    • Cryo-electron microscopy for membrane proteins resistant to crystallization

    • NMR spectroscopy for smaller membrane protein domains

    • Integrative structural biology combining multiple low-resolution techniques

Methodological approach: Researchers should employ fluorescence-detected size exclusion chromatography (FSEC) early in the process to rapidly assess expression, stability, and monodispersity of GFP-tagged constructs without the need for complete purification .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.