Recombinant Inner membrane protein yohK (yohK)

Shipped with Ice Packs
In Stock

Description

Functional Role in 3-HP Tolerance

YohJK functions as a transporter system critical for E. coli tolerance to 3-hydroxypropionic acid (3-HP):

  • Mechanism:

    • Deletion of the transcriptional regulator yieP upregulates yohJK, reducing intracellular 3-HP levels by enhancing export .

    • Overexpression of yohJK restores 3-HP tolerance in yieP mutants, confirming its role as a 3-HP exporter .

  • Specificity: The system is highly specific to 3-HP; no similar effects were observed for other C2–C4 organic acids .

Table 2: Functional Validation of YohJK

ExperimentOutcomeCitation
yohJK deletionReduced 3-HP tolerance in all strains
yohJK overexpressionRestored 3-HP export capacity
Biosensor assays80% reduction in intracellular 3-HP

Interaction Network and Partners

YohK interacts with several proteins and complexes:

  • Primary partner: YohJ (UPF0299 family protein), forming a functional transporter unit .

  • Other interactors (STRING database):

    • Cdd: Cytidine/deoxycytidine deaminase (score: 0.787) .

    • ZupT: Zinc transporter (score: 0.539) .

    • Flc: Fluoride efflux channel (score: 0.533) .

Membrane Insertion and Assembly

YohK’s integration into the inner membrane likely involves:

  • Sec-YidC holotranslocon: Membrane protein insertion in E. coli is mediated by the SecYEG–SecDF–YajC–YidC supercomplex, which facilitates the assembly of multi-pass transmembrane proteins like YohK .

  • Topology: Small inner-membrane proteins in E. coli often exhibit dual orientations, influenced by charged residues near transmembrane domains .

Biotechnological Applications

  • 3-HP production: Engineering yohJK expression improves microbial tolerance to 3-HP, a platform chemical for bioplastics .

  • Transporter studies: YohK serves as a model for studying small-molecule export mechanisms in Gram-negative bacteria .

Unresolved Questions

  • Substrate range: While linked to 3-HP, YohK’s ability to transport other substrates (e.g., serotonin, as suggested by STRING) remains untested .

  • Regulatory triggers: The environmental or metabolic signals controlling yohJK expression are unknown .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
yohK; SF2227; S2356; Inner membrane protein YohK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Shigella flexneri
Target Names
yohK
Target Protein Sequence
MMANIWWSLPLTLIVFFAARKLAARYKFPLLNPLLVAMVVIIPFLMLTGISYDSYFKGSE VLNDLLQPAVVALAYPLYEQLHQIRARWKSIITICFIGSVVAMVTGTSVALLMGASPEIA ASILPKSVTTPIAMAVGGSIGGIPAISAVCVIFVGILGAVFGHTLLNAMRIRTKAARGLA MGTASHALGTARCAELDYQEGAFSSLALVLCGIITSLIAPFLFPIILAVMG
Uniprot No.

Target Background

Database Links

KEGG: sfl:SF2227

Protein Families
YohK (E.coli)/YwbG (IPA-22R) (B.subtilis) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the yohK protein and why is it significant for research?

The yohK protein is an inner membrane protein found in Escherichia coli that serves as an important model for studying membrane protein structure and function. Membrane proteins like yohK execute critical biological functions in all living organisms and constitute approximately half of current targets for drug discovery. As a relatively small and stable membrane protein, yohK provides researchers with opportunities to investigate fundamental aspects of membrane protein biology, including protein folding, membrane insertion, and functional characterization . The recombinant expression of yohK allows for controlled production of this protein for various biochemical and structural studies, making it valuable for both basic research and potential applications in biotechnology.

What expression systems are most suitable for recombinant yohK production?

While multiple expression systems can be utilized, E. coli remains the most popular and well-established host for recombinant yohK production due to its rapid growth, well-characterized genetics, and relatively simple cultivation requirements. Specifically, engineered E. coli strains SuptoxD and SuptoxR have demonstrated superior performance for membrane protein expression, including proteins like yohK. These strains, when coexpressing the effector genes djlA or rraA respectively, can effectively suppress the cytotoxicity typically associated with membrane protein overexpression . For eukaryotic applications or when post-translational modifications are required, yeast systems (Pichia pastoris or Saccharomyces cerevisiae) may be considered as alternative expression hosts, though additional optimization would be necessary.

What are the basic components needed for a yohK expression and purification workflow?

A complete workflow for yohK expression and purification requires:

ComponentPurposeCritical Considerations
Expression vectorCarries yohK gene with appropriate regulatory elementsMust include strong but controllable promoter (e.g., T7 or arabinose-inducible)
Host strainProduces the recombinant proteinSuptoxD or SuptoxR strains show enhanced performance
Growth mediaSupports bacterial growthLB or 2xYT for standard expression; minimal media for labeled protein
Induction systemTriggers protein expressionIPTG (0.1-1.0 mM) or arabinose (0.002-0.2%) depending on promoter
DetergentsSolubilize membrane proteinsn-Dodecyl-β-D-maltopyranoside (DDM) or n-Octyl-β-D-glucopyranoside (OG)
Chromatography systemsPurify target proteinIMAC (for His-tagged constructs), ion exchange, size exclusion
Quality control methodsVerify purity and functionalitySDS-PAGE, Western blot, mass spectrometry, activity assays

The workflow should be optimized for each specific experimental goal, with careful attention to expression conditions that maximize the yield of properly folded protein .

How can I optimize the expression conditions for maximum yield of properly folded recombinant yohK?

Optimization of yohK expression requires systematic investigation of multiple parameters through designed experiments. Based on research with membrane proteins, the following approach is recommended:

  • Strain Selection: Compare standard BL21(DE3) with specialized SuptoxD and SuptoxR strains, which have been engineered specifically to suppress cytotoxicity associated with membrane protein overexpression .

  • Effector Gene Co-expression: When using SuptoxD, co-express the djlA effector; with SuptoxR, co-express the rraA effector. These combinations have demonstrated synergistic effects in enhancing membrane protein yields .

  • Temperature Modulation: Test expression at reduced temperatures (16-25°C) after induction, which typically slows protein production and improves folding compared to standard 37°C conditions.

  • Induction Protocol: Implement a design of experiments (DOE) approach to optimize:

    • Inducer concentration (e.g., 0.1-1.0 mM IPTG)

    • Cell density at induction (OD600 of 0.4-1.0)

    • Duration of expression (4-24 hours)

  • Media Composition: Evaluate complex media (LB, TB, 2xYT) against defined media supplemented with glycerol or glucose as carbon sources.

A central composite design with a fractional factorial base would be appropriate for this optimization, allowing systematic exploration of parameter space while minimizing experimental runs . Analysis should focus not just on total protein yield but specifically on the proportion of correctly folded and membrane-integrated protein.

What strategies can overcome the cytotoxicity associated with yohK overexpression?

Cytotoxicity is a significant challenge in recombinant membrane protein production. For yohK specifically, consider these research-validated approaches:

  • Engineered Host Strains: Utilize SuptoxD and SuptoxR strains, which have been specifically developed to mitigate toxicity through genetic modifications that affect cellular stress responses .

  • Chaperone Co-expression: Beyond the djlA and rraA effectors integrated into SuptoxD and SuptoxR strains, additional chaperone systems can be co-expressed, including GroEL/GroES, DnaK/DnaJ/GrpE, and trigger factor.

  • Tunable Expression Systems: Implement tightly regulated expression systems such as the arabinose-inducible pBAD system or tunable T7 expression systems with T7 lysozyme co-expression (pLysS/pLysE).

  • Membrane Engineering: Consider supplementing growth media with specific phospholipids or membrane-fluidizing agents that can accommodate additional membrane protein without disrupting cellular homeostasis.

  • Sequential Induction Protocol: Develop a two-phase growth strategy where biomass is accumulated before very gradual induction of protein expression, allowing cellular adaptation:

    • Grow cells to mid-log phase (OD600 of 0.6-0.8)

    • Cool culture to 20°C for 30 minutes

    • Add inducer at 10-20% of standard concentration

    • Increase inducer concentration incrementally over 2-3 hours

Implementing these strategies requires careful experimental design with appropriate controls to discriminate between effects on cell viability, protein expression, and proper folding/localization of the target protein .

How can structural and functional integrity of purified yohK be verified?

Comprehensive assessment of structural and functional integrity requires multiple complementary approaches:

  • Structural Assessment:

    • Circular Dichroism (CD) Spectroscopy: Provides information about secondary structure content and thermal stability

    • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): Determines oligomeric state and homogeneity

    • Limited Proteolysis: Probes compactness and domain organization

    • Fluorescence Spectroscopy: Assesses tertiary structure through intrinsic tryptophan fluorescence

    • Nuclear Magnetic Resonance (NMR): For high-resolution structural analysis if isotope labeling is performed

  • Functional Verification:

    • Substrate Binding Assays: Measure binding constants for known ligands

    • Transport Assays: If reconstituted into liposomes, measure transport activity

    • Electrophysiology: For channel or transporter functions, patch-clamp or planar lipid bilayer recordings

    • Differential Scanning Fluorimetry (DSF): Assess protein stability in presence vs. absence of ligands

  • Membrane Integration Quality:

    • Proteoliposome Reconstitution Efficiency: Quantify successful incorporation into artificial membranes

    • Detergent Resistance: Examine stability in various detergents as proxy for native folding

    • Sucrose Gradient Centrifugation: Separate properly folded protein from aggregates

These techniques should be applied in a logical sequence, starting with basic assessments (e.g., gel filtration profiles, thermal stability) before proceeding to more complex functional assays that require specialized equipment or reconstitution .

How should I design experiments to optimize detergent selection for yohK solubilization and purification?

Detergent selection is critical for maintaining membrane protein structure and function. A systematic experimental approach involves:

  • Initial Screening Phase:

    • Select 6-8 detergents from different chemical classes (maltosides, glucosides, phosphocholines, neopentyl glycols)

    • Perform small-scale extractions using a factorial design to test:

      • Detergent type

      • Detergent concentration (1-5× critical micelle concentration)

      • Solubilization time (1-24 hours)

      • Temperature (4°C vs. room temperature)

  • Evaluation Metrics:

    • Extraction efficiency (quantified by Western blot)

    • Monodispersity (assessed by analytical size exclusion chromatography)

    • Stability over time (activity retention after 24, 48, and 72 hours)

    • Compatibility with downstream applications (crystallization, NMR, functional assays)

  • Optimization Phase:

    • For the 2-3 best performing detergents, implement a central composite design to fine-tune:

      • Detergent concentration

      • Salt concentration

      • pH

      • Presence of glycerol or specific lipids

  • Validation:

    • Assess long-term stability (1-2 weeks)

    • Confirm activity in the optimized detergent system

    • Verify structural integrity through thermal denaturation studies

This approach follows established principles of experimental design for membrane protein research, ensuring that the complex multivariable problem of detergent optimization is addressed systematically rather than through one-factor-at-a-time approaches .

What experimental design approach is most appropriate for optimizing yohK crystallization conditions?

Crystallization of membrane proteins like yohK requires a specialized experimental design approach due to the multidimensional parameter space and typically low success rates:

  • Initial Sparse Matrix Screening:

    • Deploy commercial sparse matrix screens designed specifically for membrane proteins

    • Implement a fractional factorial design covering:

      • Protein concentration (5-15 mg/mL)

      • Detergent type (2-3 pre-selected options)

      • Precipitant type and concentration

      • pH range (5.5-8.5)

      • Temperature (4°C and 20°C)

  • Analysis and Optimization Strategy:

    • Apply statistical analysis to identify significant factors and interactions

    • Implement response surface methodology to navigate toward optimal conditions

    • Consider the design as sequential, with evaluation after approximately every 10-12 conditions

  • Second-Phase Optimization:

    • For promising initial hits, design a central composite experiment focusing on:

      • Fine-tuning precipitant concentration

      • Adjusting detergent concentration

      • Additive screening (lipids, small molecules)

      • Seeding protocols

  • Advanced Techniques If Standard Approaches Fail:

    • Implement lipidic cubic phase (LCP) crystallization using a similar experimental design approach

    • Consider antibody-mediated crystallization with factorial screening of antibody:protein ratios

This experimental design strategy balances comprehensive exploration of crystallization space with efficient use of typically limited protein samples. The approach incorporates principles from response surface methodology while allowing for adjustment based on intermediate results .

How can I design experiments to determine the oligomeric state of yohK in different membrane environments?

Determining the oligomeric state of membrane proteins requires multiple complementary approaches and careful experimental design:

  • In Detergent Solutions:

    • Implement a factorial design testing:

      • Detergent type (3-4 options)

      • Protein concentration (dilution series)

      • Salt concentration (150-500 mM)

    • Apply complementary techniques for each condition:

      • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

      • Analytical ultracentrifugation (AUC)

      • Chemical crosslinking followed by SDS-PAGE analysis

  • In Membrane Mimetics:

    • Design experiments comparing:

      • Nanodiscs with different scaffold proteins (MSP1D1, MSP1E3D1)

      • Liposomes of varying composition (POPC, POPE/POPG mixtures)

      • Native membrane extracts

    • For each system, measure:

      • Fluorescence resonance energy transfer (FRET) between labeled proteins

      • Single-molecule photobleaching steps

      • Freeze-fracture electron microscopy particle analysis

  • Computational Validation:

    • Molecular dynamics simulations examining stability of different oligomeric models

    • Comparison of experimental data with computational predictions

  • Data Integration:

    • Develop a statistical framework to integrate results from multiple methodologies

    • Weight evidence based on technique resolution and reliability

    • Construct models that account for potential dynamic equilibrium between oligomeric states

What are common causes of low yield in recombinant yohK expression and how can they be addressed?

Low yield in recombinant yohK expression can stem from multiple factors. The following troubleshooting framework addresses the most common issues:

ProblemPotential CausesDiagnostic ApproachSolution Strategy
Poor expressionCodon biasCheck codon adaptation indexUse codon-optimized construct
Toxic accumulationMonitor growth curves post-inductionUse SuptoxD/SuptoxR strains with djlA/rraA effectors
Promoter leakinessCheck pre-induction samplesAdd glucose to suppress basal expression
High expression but low recoveryInclusion body formationMicroscopy with fluorescent fusionReduce temperature, optimize induction
Inefficient membrane insertionCompare membrane vs. cytosolic fractionsCo-express membrane insertion machinery
DegradationTime-course Western blotAdd protease inhibitors, optimize lysis
Purification lossesInefficient solubilizationTest multiple detergentsOptimize detergent:protein ratio
Protein instabilityStability assays at different pH/saltIdentify stabilizing conditions
Non-specific bindingCompare different matricesAdjust imidazole in wash buffers

For systematic troubleshooting, implement a sequential experimental design approach:

  • First, identify the stage of loss (expression, membrane insertion, solubilization, or purification)

  • Design targeted experiments for that specific stage

  • Implement improvements and quantify their effects before moving to the next bottleneck

This approach prevents confounding variables and allows clear attribution of improvements to specific interventions .

How can I address data inconsistencies in functional assays of purified yohK?

Functional assay inconsistencies are common with membrane proteins and require systematic investigation:

  • Characterize Variability:

    • Implement a designed experiment to quantify sources of variation:

      • Between protein preparations (biological replicates)

      • Between technical replicates

      • Between days/operators

    • Use statistical tools like ANOVA to partition variance components

    • Establish control charts to monitor assay performance over time

  • Address Protein Quality Issues:

    • Develop batch-to-batch quality control metrics:

      • SEC profile consistency

      • Thermal stability measurements

      • Mass spectrometry to detect modifications

    • Implement go/no-go criteria before functional testing

    • Create reference protein standards stored in aliquots

  • Optimize Assay Conditions:

    • Design response surface experiments to identify robust assay conditions:

      • Buffer composition optimization (pH, salt, additives)

      • Temperature stability range

      • Time-dependence of measurements

    • Identify conditions that minimize variability while maintaining sensitivity

  • Standardize Protocols:

    • Develop detailed SOPs with specific attention to:

      • Sample handling/thawing procedures

      • Equipment calibration requirements

      • Data analysis pipelines

  • Consider Reconstitution Effects:

    • If assays involve reconstituted systems, design experiments to test:

      • Lipid composition effects

      • Protein:lipid ratio optimization

      • Reconstitution method comparison

This approach combines statistical design of experiments with quality control principles to systematically identify and address sources of inconsistency. By treating assay development as an optimization problem rather than a fixed protocol, researchers can develop robust methods suitable for rigorous characterization of yohK function .

What statistical approaches are most appropriate for analyzing complex datasets from yohK structure-function studies?

Structure-function studies generate multidimensional datasets requiring sophisticated statistical approaches:

  • Multivariate Analysis Techniques:

    • Principal Component Analysis (PCA): Useful for identifying patterns in spectroscopic data and reducing dimensionality

    • Partial Least Squares Regression (PLS): Relates structural parameters to functional measurements

    • Cluster Analysis: Identifies natural groupings in mutation studies or ligand screening data

  • Experimental Design and Analysis for Mutagenesis Studies:

    • Fractional factorial designs to efficiently test multiple mutations

    • Analysis of variance (ANOVA) with appropriate post-hoc tests

    • Specialized designs for interaction effects between distinct protein regions

  • Time Series Approaches for Kinetic Data:

    • Mixed-effects models for repeated measures experiments

    • Non-linear regression for fitting complex kinetic models

    • Bootstrapping for robust confidence interval estimation

  • Integrative Data Analysis Frameworks:

    • Bayesian networks for combining evidence from multiple experimental approaches

    • Cross-validation strategies to prevent overfitting

    • Sensitivity analysis to identify critical parameters

  • Visualization Approaches:

    • Heat maps for correlation matrices

    • Network diagrams for interaction studies

    • 3D structure mapping of functional data

The appropriate statistical approach should be selected based on specific experimental questions and data types. For complex studies, consultation with a biostatistician during experimental design, not just during analysis, is highly recommended. Statistical considerations should drive experimental design decisions, particularly for studies involving multiple variables or seeking to establish structure-function relationships .

How can I develop a CRISPR-Cas9 system to study yohK function in its native context?

Developing a CRISPR-Cas9 system for studying yohK in its native context requires careful design:

  • Guide RNA Design Strategy:

    • Design multiple guide RNAs targeting:

      • The yohK gene itself for knockout studies

      • Regions suitable for knock-in of reporter tags

      • Promoter regions for expression modulation

    • Evaluate guide RNA efficiency using computational tools

    • Include controls targeting non-essential genes with known phenotypes

  • Experimental Design for Genetic Modifications:

    • For knockout studies:

      • Design repair templates introducing premature stop codons

      • Include silent mutations in PAM sites to prevent re-cutting

    • For tagging experiments:

      • Design in-frame fusions with fluorescent proteins or affinity tags

      • Include flexible linkers to minimize functional interference

      • Position tags at C-terminus unless topology data suggests otherwise

  • Phenotypic Characterization Plan:

    • Implement a factorial design to assess:

      • Growth rates under different conditions

      • Membrane composition analysis

      • Stress response activation

      • Metabolic pathway function

    • Include complementation controls (wild-type yohK expression)

    • Use statistical approaches to identify condition-specific effects

  • Workflow Integration:

    • Develop a sequential experimental approach:

      • Validation of genetic modification (sequencing, PCR)

      • Confirmation of protein absence/modification (Western blot)

      • Screening-level phenotypic assessment

      • Detailed characterization of promising phenotypes

This approach ensures rigorous investigation of yohK function through precise genetic manipulation while maintaining appropriate controls and validation steps throughout the process.

What considerations are important when designing experiments to study yohK interactions with other membrane proteins?

Studying membrane protein interactions requires specialized experimental designs:

  • Selection of Interaction Detection Methods:

    • Design a multi-method validation approach using:

      • Co-immunoprecipitation with controlled detergent conditions

      • FRET or BRET for proximity detection in intact membranes

      • Crosslinking studies with mass spectrometry analysis

      • Split reporter systems (e.g., DHFR, luciferase complementation)

    • For each method, include appropriate positive and negative controls

  • Experimental Variables to Consider:

    • Design factorial experiments examining:

      • Expression levels of interaction partners

      • Membrane composition effects

      • Cellular stress conditions

      • Presence of substrates or ligands

    • Implement time-course studies to capture dynamic interactions

  • Controls and Validation Strategy:

    • Generate multiple lines of evidence through:

      • Reversed tag configurations

      • Competition with untagged proteins

      • Mutational analysis of putative interaction interfaces

      • Comparison with known interaction partners

  • Data Analysis Approach:

    • Develop quantitative metrics for interaction strength

    • Implement statistical thresholds for declaring significant interactions

    • Consider network analysis for multiple interaction studies

  • Reconstitution Studies:

    • Design experiments comparing:

      • Interactions in native membranes

      • Interactions in defined reconstituted systems

      • Effects of specific lipids on interaction stability

This experimental design framework ensures robust characterization of protein-protein interactions while addressing the specific challenges associated with membrane protein complexes.

What future research directions are most promising for yohK studies?

The field of yohK research has several promising future directions that build on current methodologies and address remaining knowledge gaps:

  • Structural Biology Advancements:

    • Application of cryo-electron microscopy for structure determination in different functional states

    • Integration of hydrogen-deuterium exchange mass spectrometry for dynamics studies

    • Computational approaches to model membrane interactions and conformational changes

  • Functional Characterization:

    • High-throughput screening to identify potential substrates or interacting molecules

    • Development of robust in vitro activity assays

    • Investigation of potential roles in membrane organization and stress response

  • Systems Biology Integration:

    • Network analysis of physical and genetic interactions

    • Transcriptomic and proteomic profiling under conditions where yohK function is critical

    • Metabolic analysis of yohK mutants under diverse environmental conditions

  • Technological Innovations:

    • Development of yohK-based biosensors

    • Exploration as a potential model system for membrane protein folding studies

    • Integration into synthetic biology circuits as a membrane-associated component

These research directions represent areas where systematic experimental design approaches can be particularly valuable, allowing efficient exploration of complex parameter spaces while generating robust, reproducible results that advance understanding of membrane protein biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.