Recombinant Inner membrane protein yqaA (yqaA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your use.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yqaA; SF2716; S2903; Inner membrane protein YqaA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Shigella flexneri
Target Names
yqaA
Target Protein Sequence
MSEALSLFSLFASSFLSATLLPGNSEVVLVAMLLSGISHPWVLVLTATMGNSLGGLTNVI LGRFFPLRKTSRWQEKATGWLKRYGAVTLLLSWMPVVGDLLCLLAGWMRISWGPVIFFLC LGKALRYVAVAAATVQGMMWWH
Uniprot No.

Target Background

Database Links

KEGG: sfl:SF2716

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Inner membrane protein YqaA and which protein family does it belong to?

YqaA is an inner membrane protein in Escherichia coli belonging to the DedA protein family, a highly conserved and ancient family of membrane proteins with representatives in most sequenced genomes . The DedA family is characterized by extensive gene duplication in prokaryotes, with most bacterial genomes carrying two or more homologues. E. coli specifically carries eight DedA genes: ydjX, ydjZ, yabI, dedA, yohD, yqjA, yqaA, and yghB . YqaA is one of these eight family members encoded in the E. coli genome.

How does YqaA fit within the functional classification of DedA family proteins?

Studies have identified two functional groups within the E. coli DedA protein family:

  • Complementing group (C group): Includes YqjA, YghB, YabI, and YohD, which can complement temperature sensitivity and cell division defects in strain BC202 (ΔyghB::kanR, ΔyqjA::tetR)

  • Non-complementing group (NC group): Includes EcDedA, YdjX, YdjZ, and YqaA, which cannot complement these defects

This functional classification suggests distinct roles for different DedA family members despite their sequence similarity.

What are the optimal expression systems for recombinant YqaA protein production?

For effective expression of recombinant YqaA, E. coli-based expression systems have been successfully employed . The most common approach involves:

  • Cloning the yqaA gene into an expression vector with an N-terminal His tag

  • Transforming the construct into E. coli expression strains

  • Inducing expression under optimized conditions

This methodology is preferred because:

  • E. coli is the native host of YqaA, providing an appropriate membrane environment

  • The system allows for proper insertion of this integral membrane protein into the bacterial inner membrane

  • His-tagging facilitates subsequent purification while maintaining protein functionality

What purification methods are most effective for obtaining functional YqaA protein?

Purification of membrane proteins like YqaA requires specialized techniques to maintain their native structure and function:

  • Membrane isolation: Cell disruption followed by differential centrifugation to isolate membrane fractions

  • Solubilization: Using appropriate detergents to extract YqaA from membranes

  • Affinity chromatography: Utilizing the His-tag for purification with Ni-NTA or similar matrices

  • Buffer optimization: Maintaining protein stability with appropriate buffers containing:

    • Tris/PBS-based buffer, pH 8.0

    • 6% Trehalose as a stabilizing agent

For reconstitution after lyophilization, it is recommended to:

  • Brief centrifugation prior to opening

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C

What are the proposed functions of YqaA and other DedA family proteins?

Multiple studies suggest that DedA family proteins, including YqaA, may function as:

  • Membrane transporters involved in proton-dependent transport

  • Proteins essential for maintenance of proton motive force (PMF)

  • Components required for membrane integrity and homeostasis

Specifically, YqaA may be involved in:

  • Metal ion transport, as suggested by studies on homologs involved in indium efflux

  • Membrane lipid homeostasis, based on structural similarities to other membrane proteins

  • Collective essential functions with other DedA family members, as demonstrated by viability studies

How can researchers design experiments to distinguish YqaA's specific function from other DedA family members?

To differentiate YqaA's function from other DedA family members, consider the following experimental approaches:

  • Complementation studies:

    • Express YqaA in DedA family mutants (e.g., BC202) to assess functional redundancy

    • Create point mutations in conserved residues to identify critical functional domains

  • Membrane potential analysis:

    • Use membrane potential-sensitive dyes like JC-1 to measure effects of YqaA deletion/overexpression

    • Compare ΔΨ measurements between wild-type and yqaA mutant strains

  • Transport assays:

    • Monitor substrate transport across membranes in presence/absence of YqaA

    • Test various potential substrates including ions, lipids, or drugs

  • Protein-protein interaction studies:

    • Perform co-immunoprecipitation to identify interaction partners

    • Use bacterial two-hybrid systems to map interaction networks

What site-directed mutagenesis approaches have been informative for DedA family functional studies?

For YqaA and related DedA family proteins, the following mutagenesis approaches have provided valuable insights:

  • Membrane-embedded acidic residues:

    • Glutamic acid (E) and aspartic acid (D) residues in the first transmembrane-spanning (TMS) region are critical for function in related DedA proteins

    • In YqjA/YghB, E39A and D51A mutations abolished function without affecting protein expression

  • Conserved motifs:

    • Targeting residues in conserved family motifs

    • Creating chimeric proteins between complementing and non-complementing family members

These approaches can be applied to YqaA to identify critical functional residues and domains.

How does YqaA compare structurally and functionally to other DedA family proteins?

Within the DedA family, YqaA has:

  • Structural features:

    • Approximately 25-60% amino acid identity with other E. coli DedA family members

    • Similar predicted membrane topology to other family members

    • Belongs to a superfamily potentially related to LeuT-type transporters

  • Functional distinctions:

    • Unlike YqjA and YghB, YqaA cannot complement the temperature sensitivity and cell division defects of BC202

    • May have distinct substrate specificity or transport mechanism

    • Functions in a different biological context despite structural similarities

What experimental approaches can distinguish between the two functional groups (C and NC) of DedA family proteins?

To investigate the functional differences between complementing (C) and non-complementing (NC) groups:

  • Domain swapping experiments:

    • Create chimeric proteins between YqaA (NC group) and YqjA/YghB (C group)

    • Identify domains responsible for functional differences

  • Transcriptional analysis:

    • Compare expression patterns of C and NC group genes under various stress conditions

    • Identify differential regulation mechanisms

  • Localization studies:

    • Determine if subcellular localization differs between groups

    • Use fluorescent protein fusions to track protein distribution

  • Evolutionary analysis:

    • Compare conservation patterns between the two groups

    • Identify selective pressures on different family members

How can structural prediction methods be applied to study YqaA's membrane topology?

Advanced structural prediction approaches for YqaA include:

  • Co-evolution-based contact prediction:

    • Using multiple sequence alignments (MSAs) to predict residue-residue contacts

    • Applying methods like CCMPRED v0.1 or GREMLIN to generate contact maps

  • Iterative hybridization protocols:

    • Combining ab initio modeling with contact-guided refinement

    • Using Rosetta-based approaches as described in structural studies

  • Membrane-specific prediction tools:

    • TMHMM server 2.0 and CCTOP (Constrained Consensus Topology Prediction) for transmembrane helix prediction

    • PSORTb v3.0.3 for protein localization prediction

These methods can achieve significantly better structural models than traditional homology modeling approaches, especially for membrane proteins like YqaA.

What is the collective essentiality phenomenon observed in DedA family proteins and how does it impact YqaA research?

The collective essentiality of DedA family proteins presents a unique research consideration:

  • Experimental evidence:

    • Individual deletion of any DedA family gene, including yqaA, does not affect viability

    • Deletion of all eight DedA family genes is lethal unless one family member is expressed from an inducible promoter

  • Research implications:

    • Single-gene knockout studies may not reveal YqaA's function due to compensation by other family members

    • Multiple gene deletion approaches are necessary

    • Conditional expression systems (e.g., arabinose-inducible promoters) are required for studying complete DedA family loss

  • Experimental design considerations:

    • Strains like BAL801 and BAL802 with all DedA genes deleted and complemented by a single inducible gene provide valuable research tools

    • Growth in glucose (repressing conditions) results in cell death, allowing for controlled study of DedA family depletion

How might YqaA be involved in antimicrobial resistance mechanisms?

Evidence suggests potential roles for YqaA and DedA family proteins in antimicrobial resistance:

  • Connection to proton motive force (PMF):

    • DedA family proteins are implicated in PMF maintenance

    • PMF is critical for numerous drug efflux systems

  • Impact on drug sensitivity:

    • DedA mutants show increased sensitivity to certain cationic biocides

    • Disruption of PMF can sensitize bacteria to multiple antibiotics

  • Research approaches:

    • Compare minimum inhibitory concentrations (MICs) of various antibiotics in wild-type vs. yqaA mutant strains

    • Investigate potential synergistic effects between YqaA inhibition and conventional antibiotics

    • Examine expression levels of yqaA in drug-resistant clinical isolates

What are the primary technical challenges in studying YqaA and other membrane proteins?

Researchers face several challenges when working with YqaA:

  • Protein expression and purification:

    • Membrane proteins are difficult to express at high levels

    • Maintaining functional conformation during purification requires specialized detergents

    • Reconstitution into artificial membrane systems presents technical hurdles

  • Functional redundancy:

    • Overlapping functions with other DedA family members masks phenotypes

    • Requires multiple gene deletions to observe clear phenotypes

  • Structural analysis:

    • Membrane proteins are challenging for crystallization and structural determination

    • Requires specialized approaches like cryo-electron microscopy or advanced computational prediction

What emerging technologies might advance YqaA research in the near future?

Several promising technologies may accelerate YqaA research:

  • Cryo-electron microscopy:

    • Recent advances allow structural determination of membrane proteins without crystallization

    • Can reveal detailed structural features of YqaA in membrane environments

  • Advanced computational structure prediction:

    • Methods combining co-evolution data with deep learning approaches

    • Improved membrane protein modeling algorithms

  • CRISPR-Cas9 technologies:

    • Precise genome editing for creating multiple knockout strains

    • CRISPRi for tunable repression of multiple DedA family genes simultaneously

  • Nanodiscs and membrane mimetics:

    • Advanced systems for reconstituting and studying membrane proteins in near-native environments

    • Allow for detailed functional and structural studies

How might studying YqaA contribute to broader understanding of bacterial membrane biology?

YqaA research has potential to impact several areas of bacterial membrane biology:

  • Membrane transport mechanisms:

    • Insights into novel transport processes in bacterial membranes

    • Understanding of PMF maintenance mechanisms

  • Essential gene networks:

    • Understanding of collective essentiality phenomena

    • Insights into functional redundancy in bacterial genomes

  • Membrane protein evolution:

    • The ancient and conserved nature of DedA family makes it valuable for evolutionary studies

    • Insights into essential membrane protein functions conserved across bacteria

  • Antibiotic development:

    • DedA family proteins as potential novel targets for antibacterial development

    • Understanding resistance mechanisms mediated through membrane transport

What are the recommended protocols for isolating bacterial membrane fractions for YqaA studies?

For effective isolation of membrane fractions containing YqaA:

  • Ultracentrifugation (UC) method:

    • Cell disruption followed by differential centrifugation

    • Sequential centrifugation steps to separate inner and outer membranes

    • Advantages: Good separation of membrane types

    • Limitations: Time-consuming, lower yields (24.8% reduction compared to UF)

  • Ultrafiltration (UF) method:

    • More rapid isolation, higher yields

    • Enriches smaller-sized membrane vesicles (0-100 nm diameter)

    • Recommended for applications requiring higher yields

Comparison of isolation methods shows significant differences in particle recovery:

MethodRelative YieldEnriched Size RangeProcessing Time
UCLower200-550 nmLonger
UFHigher0-100 nmShorter

These differences should be considered when designing experiments targeting YqaA .

How can researchers quantify YqaA protein levels in experimental settings?

Several complementary approaches for YqaA quantification include:

  • Western blotting:

    • Using anti-His antibodies for recombinant His-tagged YqaA

    • Custom antibodies against YqaA-specific epitopes

    • Provides semi-quantitative analysis of expression levels

  • Mass spectrometry:

    • Targeted proteomics approaches for absolute quantification

    • Label-free or isotope-labeled quantification methods

  • Protein assays for membrane fractions:

    • Total protein (BCA assay) combined with Western blotting

    • Lipid phosphorous assays to normalize membrane protein content

  • Fluorescent protein fusions:

    • For in vivo tracking and quantification of YqaA

    • Caution needed to ensure fusion doesn't disrupt function

What genetic approaches are most effective for studying YqaA in the context of DedA family redundancy?

To address functional redundancy challenges:

  • Multiple gene deletion strategies:

    • Sequential deletion of DedA family genes using λ Red recombination system

    • FLP recombinase-mediated removal of antibiotic resistance cassettes between deletions

    • PCR verification of deletions before proceeding to next gene deletion

  • Controlled expression systems:

    • Arabinose-inducible promoter systems (pBAD vectors)

    • Tunable expression to determine minimum functional levels

  • Complementation testing:

    • Expression of YqaA in strains lacking multiple DedA family members

    • Assessment of growth, cell division, and other phenotypes

  • Site-directed mutagenesis:

    • Creating point mutations in conserved residues

    • Analyzing effects on protein function and cell phenotypes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.