Recombinant Inner membrane transport permease yadH (yadH)

Shipped with Ice Packs
In Stock

Description

Protein Identification and Nomenclature

YadH is encoded by the yadH gene (UniProt ID: P0AFN6) in E. coli K-12 and is classified as an inner membrane transport permease . It shares homology with proteins in other E. coli strains, including E. coli O6:H1 (CFT073) . Key identifiers include:

PropertyValue
Gene NameyadH
SynonymsZ0139, ECs0132, Inner membrane transport permease YadH
UniProt IDP0AFN6 (K-12), P0AFN7 (O6:H1)
Protein Length256 amino acids
Molecular Weight~28.6 kDa (predicted)

Functional Roles and Mechanisms

YadH is implicated in two primary biological processes:

Outer Membrane Lipid Asymmetry

YadH collaborates with the Mla (Maintenance of Lipid Asymmetry) system (MlaFEDCB) to preserve phospholipid asymmetry between the inner and outer membranes . This system prevents lipid flipping to the outer membrane, a critical defense against antimicrobial peptides and environmental stressors.

Research Applications and Implications

YadH’s recombinant form is valuable for:

  1. Lipid Asymmetry Studies: Probing interactions with the Mla system and membrane stability .

  2. Antibiotic Resistance Research: Investigating outer membrane integrity mechanisms in pathogenic E. coli (e.g., UPEC strain CFT073) .

  3. Membrane Transporter Engineering: Exploring novel transport mechanisms in synthetic biology.

Key Research Findings

StudyFindingsSource
Lipid asymmetry roleYadH and Mla system jointly maintain outer membrane lipid composition
Recombinant productionFull-length His-tagged YadH expressed in E. coli for structural studies
Sequence analysis12-TM helix topology, conserved Gly/Arg residues

Unresolved Questions

  • Substrate Specificity: YadH’s transported substrates remain unknown.

  • Functional Classification: Discrepancies exist regarding its classification as an ABC transporter vs. permease .

  • Structural Dynamics: Mechanistic details of conformational changes are uncharacterized.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize development of that specific tag.
Synonyms
yadH; Z0139; ECs0132; Inner membrane transport permease YadH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-256
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
yadH
Target Protein Sequence
MMHLYWVALKSIWAKEIHRFMRIWVQTLVPPVITMTLYFIIFGNLIGSRIGDMHGFSYMQ FIVPGLIMMSVITNAYANVASSFFGAKFQRNIEELLVAPVPTHVIIAGYVGGGVARGLFV GILVTAISLFFVPFQVHSWVFVALTLVLTAVLFSLAGLLNGVFAKTFDDISLVPTFVLTP LTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGINDVPLVTTFGVLVVFIVAF YLICWSLIQRGRGLRS
Uniprot No.

Target Background

Database Links

KEGG: ece:Z0139

STRING: 155864.Z0139

Protein Families
ABC-2 integral membrane protein family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is inner membrane transport permease YadH?

Inner membrane transport permease YadH is a membrane protein encoded in the genome of Escherichia coli K-12. It belongs to the family of membrane transport proteins and is thought to facilitate the movement of specific substrates across the bacterial inner membrane. The protein is identified by UniProt ID P0AFN6 and is classified as a provisional inner membrane transport permease . The primary sequence consists of 221 amino acids with a predicted molecular weight of approximately 24 kDa. YadH contains multiple transmembrane domains that anchor it within the lipid bilayer of the bacterial inner membrane, allowing it to form a channel or pore structure necessary for its transport function .

How does YadH relate to other membrane transport systems in bacteria?

YadH functions within the complex landscape of bacterial membrane transport systems. While SecYEG translocon serves as the primary pathway for protein translocation across or into the inner membrane, specialized transporters like YadH likely handle specific substrates . YadH appears to be part of the diverse array of inner membrane transporters that collectively constitute approximately 10% of all bacterial genes, emphasizing their functional significance .

Unlike the BAM complex that facilitates outer membrane protein insertion, YadH operates in the inner membrane environment, potentially working in conjunction with systems like the SecYEG-translocon or independently . Based on sequence analysis, YadH likely facilitates passive transport rather than active transport, allowing substrates to move across the membrane without direct energy input, though this requires experimental confirmation through transport assays .

What are the optimal conditions for recombinant expression of YadH?

The optimal conditions for recombinant expression of YadH involve careful consideration of expression systems, growth parameters, and induction strategies:

ParameterRecommended ConditionRationale
Expression hostE. coli C41(DE3) or C43(DE3)These strains are specifically engineered for membrane protein expression with reduced toxicity
Expression vectorpET-based with T7 promoterProvides tight regulation and high expression upon induction
Growth mediumTerrific Broth supplemented with 0.5% glucoseRich medium supports higher cell density; glucose reduces basal expression
Growth temperature30°C pre-induction, 18°C post-inductionLower post-induction temperature reduces inclusion body formation
Induction0.1-0.5 mM IPTG at OD600 0.6-0.8Lower IPTG concentrations favor proper membrane insertion
Post-induction time12-16 hoursExtended expression time at lower temperature improves yield of functional protein

For isotope labeling studies, minimal media with 15N ammonium chloride and/or 13C glucose should be used. Membrane protein expression levels should be monitored via Western blotting during optimization, as overexpression can saturate the membrane insertion machinery leading to misfolded protein .

What extraction and purification methods are most effective for obtaining functional YadH?

Extraction and purification of functional YadH requires a systematic approach to maintain protein stability and function:

  • Membrane isolation: Harvest cells and disrupt by French press or sonication in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and protease inhibitors. Separate membranes from cytosolic fraction by ultracentrifugation (100,000 × g, 1 hour) .

  • Detergent screening: Effective solubilization of YadH requires screening multiple detergents. A recommended panel includes:

DetergentConcentrationCharacteristics
n-Dodecyl-β-D-maltoside (DDM)1%Mild detergent, often preserves function
n-Octyl-β-D-glucopyranoside (OG)1.5%Intermediate harshness, good for crystallization
Lauryl maltose neopentyl glycol (LMNG)0.5%Stabilizes membrane proteins, low CMC
Digitonin1%Very mild, preserves protein-lipid interactions
  • Affinity purification: Using a His-tagged construct, purify with Ni-NTA chromatography under gentle conditions (low imidazole for washing, 250-300 mM imidazole for elution) .

  • Size exclusion chromatography: Further purify using size exclusion in buffer containing 0.03-0.05% detergent to remove aggregates and ensure monodispersity.

  • Functional assessment: Reconstitute purified YadH into proteoliposomes to verify transport activity using fluorescent substrate analogs or radiolabeled compounds .

The critical factor is maintaining the protein in a detergent environment that preserves its native conformation throughout purification, as membrane proteins can rapidly denature when removed from the lipid bilayer .

How can researchers effectively measure YadH transport activity in vitro?

Measuring YadH transport activity requires reconstitution of the purified protein in a membrane environment that recapitulates its native function. Several complementary approaches are recommended:

  • Proteoliposome-based transport assays: Reconstitute purified YadH into liposomes composed of E. coli lipid extract at protein-to-lipid ratios of 1:100 to 1:200. Transport can be measured by:

    • Fluorescent substrate accumulation using membrane-impermeable fluorophores

    • Substrate counterflow measurements where internal and external substrates are exchanged

    • Radiolabeled substrate uptake with rapid filtration to separate proteoliposomes from external medium

  • Solid-supported membrane electrophysiology: This technique measures charge movement across a membrane during transport cycles and can detect electrogenic transport with high sensitivity:

ParameterTypical SettingsNotes
Membrane composition70% DOPC, 30% DOPEMimics bacterial membrane fluidity
Protein density50-100 ng/mm²Ensures sufficient signal
Buffer conditions10-50 mM HEPES pH 7.4, 100 mM KClPhysiological ionic strength
Substrate concentration1 μM to 10 mM rangeFor Km determination
  • Microscale thermophoresis (MST): To measure substrate binding, label purified YadH with a fluorescent dye at a non-functional site and measure the thermophoretic movement in response to increasing substrate concentrations .

  • Stopped-flow spectroscopy: Use to measure rapid conformational changes associated with transport by monitoring intrinsic tryptophan fluorescence or introduced fluorescent probes during substrate binding and transport events .

The choice of substrate is critical, as YadH's natural substrate may not be definitively known. Testing a panel of potential substrates is recommended, starting with small polar metabolites based on structural homology to related transporters .

What genetic approaches can be used to study YadH function in vivo?

Several genetic approaches are valuable for characterizing YadH function in the native cellular environment:

  • Gene deletion and complementation: Generate a ΔyadH knockout strain and assess phenotypic changes. Complement with plasmid-expressed wild-type YadH to confirm phenotype reversal. Key phenotypes to assess include:

    • Growth kinetics in various media compositions

    • Membrane integrity via permeability assays

    • Transport of potential substrates using radioisotope uptake

    • Stress response activation using reporter constructs

  • Site-directed mutagenesis: Create point mutations in conserved residues predicted to be involved in transport function:

    • Mutations in the putative substrate binding pocket

    • Alterations to charged residues in transmembrane domains

    • Modifications to potential gating regions

    • Substitutions in coupling domains that may interact with energy sources

  • Fusion reporter constructs: Generate translational fusions with reporters like GFP or split-GFP to monitor:

    • Localization within the membrane

    • Expression levels under different conditions

    • Protein-protein interactions via FRET or BiFC approaches

  • Suppressor mutant screening: Identify genetic interactions by selecting for suppressor mutations that restore function in partially defective YadH variants, revealing functional partners or alternative pathways .

  • Transcriptional regulation analysis: Use reporter fusions to the yadH promoter to identify conditions that regulate expression, providing clues to physiological function .

These genetic approaches should be combined with biochemical and physiological measurements to build a comprehensive understanding of YadH function within the cellular context.

How does YadH contribute to bacterial membrane organization and homeostasis?

YadH likely plays an important role in bacterial membrane organization and homeostasis through several mechanisms:

  • Lipid domain organization: As an integral membrane protein, YadH may contribute to the formation of specialized lipid domains within the inner membrane. Using fluorescently labeled lipid probes and super-resolution microscopy, researchers can observe how YadH expression affects membrane microdomain formation .

  • Membrane potential maintenance: If YadH transports charged substrates, it may directly influence the electrochemical gradient across the inner membrane. Membrane potential can be measured in wild-type versus ΔyadH strains using voltage-sensitive dyes like DiSC3(5) or through patch-clamp electrophysiology of bacterial spheroplasts .

  • Response to membrane stress: YadH expression may be regulated as part of the cell envelope stress response. Experiments examining yadH transcription under conditions of membrane stress (detergents, antimicrobial peptides, osmotic shock) using qRT-PCR or reporter fusions can reveal its role in adaptive responses .

  • Interaction with membrane biogenesis machinery: YadH may interact with components of membrane protein insertion machinery like SecYEG or YidC. These interactions can be probed through techniques such as:

    • Co-immunoprecipitation with tagged YadH

    • Bacterial two-hybrid assays

    • Chemical crosslinking followed by mass spectrometry

    • Genetic synthetic lethality screens

The contribution of YadH to membrane homeostasis is likely substrate-specific, making the identification of its natural substrate(s) a critical research question.

What structural dynamics are involved in YadH transport mechanism?

Understanding the structural dynamics of YadH transport requires sophisticated biophysical approaches to capture conformational changes during the transport cycle:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of YadH that undergo conformational changes upon substrate binding. Regions with altered deuterium uptake patterns in the presence versus absence of substrate indicate potential conformational flexibility important for transport .

  • Single-molecule FRET (smFRET): By introducing fluorescent probes at strategic positions, researchers can monitor distance changes between protein domains during transport:

FRET Pair PositionExpected Conformational ChangePhysiological Significance
TM1-TM7Opening/closing of lateral gateSubstrate entry pathway
Periplasmic loopsMovement during transport cycleExtracellular accessibility changes
Cytoplasmic domainsRearrangement upon substrate bindingCoupling to cellular energy
  • Molecular dynamics simulations: Using structural models, simulate YadH behavior in a lipid bilayer environment to predict:

    • Substrate binding sites and pathways

    • Conformational changes during transport

    • Energy barriers in the transport process

    • Lipid-protein interactions that stabilize functional states

  • Cysteine accessibility scanning: Introduce cysteine residues throughout YadH and measure their accessibility to membrane-impermeable sulfhydryl reagents in different conformational states to map structural transitions .

  • Cryo-electron microscopy: Capture YadH in different conformational states by stabilizing with antibodies, nanobodies, or conformation-specific inhibitors to construct a model of the transport cycle .

These approaches collectively can reveal the alternating access mechanism likely employed by YadH, where substrate binding sites are alternately exposed to different sides of the membrane during transport.

How can researchers address common challenges in YadH overexpression and purification?

Membrane protein research presents unique challenges. Here are solutions to common problems encountered with YadH:

  • Low expression yield:

    • Problem: Toxic effects of membrane protein overexpression

    • Solutions:

      • Use C41(DE3) or Lemo21(DE3) strains designed for membrane proteins

      • Reduce induction temperature to 18°C

      • Use milder induction with lower IPTG concentrations (0.1-0.2 mM)

      • Consider auto-induction media for gradual protein expression

      • Add 0.5-1% glucose to expression media to reduce basal expression

  • Protein aggregation during purification:

    • Problem: Loss of native structure during extraction

    • Solutions:

      • Screen multiple detergents using FSEC (Fluorescence Size Exclusion Chromatography)

      • Add lipids (0.1-0.2 mg/ml E. coli lipid extract) during solubilization

      • Include glycerol (10-20%) in all buffers to stabilize protein

      • Use shorter purification protocols to minimize time in detergent

  • Inactive protein after reconstitution:

    • Problem: Loss of function during purification/reconstitution

    • Solutions:

      • Verify proper orientation in proteoliposomes using protease protection assays

      • Test multiple reconstitution methods (detergent dialysis, rapid dilution, direct incorporation)

      • Include potential stabilizing ligands during purification

      • Use gentler detergents even if yields are lower

  • Poor crystallization or structural analysis:

    • Problem: Conformational heterogeneity

    • Solutions:

      • Use conformation-specific antibodies or nanobodies to stabilize specific states

      • Introduce mutations to lock the protein in defined conformations

      • Consider crystallization in lipidic cubic phase instead of detergent

Careful optimization of each step from expression to functional analysis is critical for successful YadH research.

How can contradictory data in YadH function studies be reconciled?

Contradictory results in YadH functional studies may stem from several sources. Here's a systematic approach to reconciling conflicting data:

TechniqueStrengthLimitationComplementary Approach
Radioisotope uptakeDirect quantificationBackground bindingCounterflow assays
Fluorescence-basedReal-time kineticsPotential interferenceDirect substrate quantification
ElectrophysiologyHigh sensitivityTechnical complexityBulk transport assays
In vivo phenotypingPhysiological relevanceIndirect measurementIn vitro reconstitution
  • Data interpretation frameworks:

    • Different transport models may explain the same data

    • Solution: Design critical experiments that specifically distinguish between competing models, rather than collecting data that is compatible with multiple interpretations

Careful documentation of all experimental conditions, rigorous controls, and independent verification using orthogonal methods are essential to resolve contradictions in the literature.

What emerging technologies could advance our understanding of YadH?

Several cutting-edge technologies offer promising avenues for deeper insights into YadH structure and function:

  • Cryo-electron tomography: This technique allows visualization of membrane proteins in their native cellular environment. For YadH research, this could reveal:

    • Natural distribution and clustering within the membrane

    • Associations with other membrane complexes

    • Structural changes under different physiological conditions

  • Integrative structural biology approaches: Combining multiple techniques provides more comprehensive structural insights:

    • AlphaFold predictions as starting models

    • Validation and refinement with experimental constraints from HDX-MS

    • Dynamic information from NMR and smFRET

    • High-resolution details from cryo-EM

  • Advanced reconstitution systems:

    • Nanodiscs with defined lipid composition to study lipid-protein interactions

    • Microfluidic-based proteoliposome formation for high-throughput functional screening

    • Droplet interface bilayers for single-channel measurements

  • Genome-wide interaction screens:

    • CRISPR interference screens to identify genetic interactions

    • Systematic chemical-genetic profiling to understand functional relationships

    • Global protein interaction mapping using proximity labeling approaches

  • In silico drug design and molecular docking:

    • Virtual screening against YadH structural models to identify potential inhibitors or modulators

    • Structure-based design of specific transport inhibitors as research tools

These technologies, particularly when applied in combination, have the potential to revolutionize our understanding of YadH function and its role in bacterial physiology.

What are the implications of YadH research for antimicrobial development?

YadH research has significant implications for novel antimicrobial development strategies:

Understanding the fundamental biology of YadH provides the foundation for rational approaches to antimicrobial development targeting this or related membrane transport systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.