Recombinant Inner membrane transport permease ybhR (ybhR)

Shipped with Ice Packs
In Stock

Description

Domain Architecture

  • Transmembrane Domains (TMDs): Facilitate substrate recognition and transport across the inner membrane .

  • Cytoplasmic Loops: Interact with ATP-binding component YbhF for energy coupling .

Operon Organization

The ybhFSR operon includes:

  • ybhF: ATP-binding subunit

  • ybhS: Additional permease subunit

  • ybhR: Core permease subunit

A recombinant variant often disrupts native operons (e.g., ybiH/ybhG/ybhF/ybhS/ybhR) to optimize efflux capabilities .

Dual Transport Mechanisms

YbhFSR exhibits two primary functions:

  1. Drug Efflux Pump

    • Substrates: Tetracyclines (tetracycline, doxycycline), ethidium bromide (EB), Hoechst33342 .

    • Mechanism: ATP hydrolysis by YbhF drives extrusion via YbhR/YbhS transmembrane channels .

  2. Na⁺(Li⁺)/H⁺ Antiporter

    • Compensates for ionic stress in E. coli under high NaCl/LiCl or alkaline conditions .

Key Experimental Findings

SubstrateMIC (μg/ml) in △acrB StrainAccumulation Reduction (%)
Tetracycline4.0 (vs. 0.5 in WT)62%
Ethidium Bromide256 (vs. 64 in WT)58%
Hoechst3334232 (vs. 8 in WT)51%
Data from MIC assays and fluorescence-based efflux studies .

Hydrocarbon Secretion

  • Engineered Synechococcus strains expressing YbhFSR-TolC efflux pumps show enhanced secretion of alkanes/alkenes (e.g., pentadecane) for biofuel production .

  • Modifications include operon redesign (e.g., promoter replacement) and fusion with pseudo-leader sequences (PLS) for plasma membrane targeting .

Drug Resistance Studies

  • Knockout strains (△ybhF) exhibit heightened sensitivity to cefoperazone and chloramphenicol, confirming YbhFSR's role in antibiotic resistance .

Research Challenges and Innovations

  • Expression Optimization: Tagging (His-tag) and host selection (E. coli vs. Shigella) impact protein stability and activity .

  • Structural Studies: Cryo-EM and homology modeling (e.g., ModBase) remain critical for elucidating substrate-binding pockets .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific requirement for the format, please indicate it in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag
Synonyms
ybhR; Z1012; ECs0870; Probable multidrug ABC transporter permease YbhR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-368
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
ybhR
Target Protein Sequence
MFHRLWTLIRKELQSLLREPQTRAILILPVLIQVILFPFAATLEVTNATIAIYDEDNGEH SVELTQRFARASAFTHVLLLKSPQEIRPTIDTQKALLLVRFPADFSRKLDTFQTAPLQLI LDGRNSNSAQIAANYLQQIVKNYQQELLEGKPKPNNSELVVRNWYNPNLDYKWFVVPSLI AMITTIGVMIVTSLSVAREREQGTLDQLLVSPLTTWQIFIGKAVPALIVATFQATIVLAI GIWAYQIPFAGSLALFYFTMVIYGLSLVGFGLLISSLCSTQQQAFIGVFVFMMPAILLSG YVSPVENMPVWLQNLTWINPIRHFTDITKQIYLKDASLDIVWNSLWPLLVITATTGSAAY AMFRRKVM
Uniprot No.

Target Background

Function
Part of the ABC transporter complex YbhFSR, which may be involved in the efflux of cefoperazone. It is likely involved in the translocation of the substrate across the membrane.
Database Links

KEGG: ece:Z1012

STRING: 155864.Z1012

Protein Families
ABC-2 integral membrane protein family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YbhR and what is its role in bacterial membrane transport?

YbhR is a predicted membrane component of the YbhFSR ABC transporter complex found in Escherichia coli and related bacteria. It functions as part of a multicomponent system where YbhF serves as the ATP-binding component, while YbhS and YbhR act as the membrane components that form the transmembrane channel . As part of this complex, YbhR contributes to the dual function of YbhFSR as both a drug efflux pump and a Na+(Li+)/H+ antiporter . This transporter system helps bacteria regulate ion homeostasis and export potentially harmful compounds, including certain antibiotics.

How does YbhR differ from other membrane transport permeases?

YbhR functions specifically within the YbhFSR complex, which has been characterized as having dual functionality as both a drug efflux system and an ion antiporter . Unlike general porins that form trimeric β-barrels with relatively little specificity, YbhR belongs to a class of specific membrane transporters . Its function is integrated within a complete ABC transporter system that requires ATP hydrolysis by the YbhF component to power substrate transport. When comparing YbhR to other membrane components like LptF and LptG (which are involved in lipopolysaccharide transport), YbhR has distinct substrate specificity focused on tetracyclines and certain dyes rather than lipopolysaccharide molecules .

What is the full structure of the YbhFSR complex and how does YbhR fit into it?

The YbhFSR complex is an ABC transporter with YbhF containing two nucleotide binding domains (NBDs) that bind and hydrolyze ATP to power transport . YbhS and YbhR are predicted membrane components that form the transmembrane channel through which substrates are transported. The full-length YbhR protein consists of 368 amino acids . The complex functions as a unified system where conformational changes in YbhF upon ATP binding and hydrolysis are transmitted to YbhS and YbhR, causing changes in their configuration that facilitate substrate movement across the membrane. This coordinated action enables both drug efflux and ion antiport functions.

What are the most effective methods for expressing and purifying recombinant YbhR protein?

For effective recombinant YbhR expression and purification, researchers typically use E. coli expression systems with His-tagged constructs. The protocol should include:

  • Construct preparation: Clone the ybhR gene into an expression vector with a His-tag (preferably at C-terminus to avoid interference with membrane insertion)

  • Transformation: Transform into an appropriate E. coli strain (BL21(DE3) or C43(DE3) for membrane proteins)

  • Expression conditions: Grow cells in LB medium with appropriate antibiotics until OD600 reaches 0.5-0.6

  • Induction: Add 1 mM IPTG and continue incubation at 37°C for 4 hours

  • Membrane fraction isolation: Harvest cells, lyse, and separate membrane fractions through ultracentrifugation

  • Solubilization: Use mild detergents (DDM or LDAO) to solubilize membrane proteins

  • Purification: Use nickel-nitrilotriacetic acid resin affinity chromatography to purify His-tagged YbhR

  • Analysis: Verify purification using SDS-PAGE and Western blotting

This approach has been successfully employed for similar membrane proteins in the ABC transporter family.

How can researchers effectively study YbhR function in vitro and in vivo?

For comprehensive functional analysis of YbhR, researchers should implement complementary in vitro and in vivo approaches:

In vitro approaches:

  • Proteoliposome reconstitution: Incorporate purified YbhR together with YbhF and YbhS into artificial liposomes to study transport activity

  • ATPase activity assays: Use malachite green assay to measure ATP hydrolysis by the reconstituted complex

  • Substrate binding assays: Employ fluorescence-based assays with labeled substrates to measure binding affinity

In vivo approaches:

  • Gene knockout studies: Create ybhR knockout strains and assess phenotypic changes in growth and antibiotic resistance

  • Minimum Inhibitory Concentration (MIC) determination: Compare wild-type and knockout strains for resistance to tetracyclines and other potential substrates

  • Fluorescent substrate accumulation assays: Use ethidium bromide or Hoechst33342 to measure intracellular accumulation in wild-type versus knockout strains

  • Complementation studies: Reintroduce ybhR to knockout strains to confirm restored function

  • Site-directed mutagenesis: Create point mutations to identify critical residues for function

These methodologies provide complementary data on YbhR's role within the YbhFSR complex and should be used in combination for conclusive results.

What expression systems are optimal for producing functional recombinant YbhR?

The optimal expression systems for producing functional recombinant YbhR should address the challenges inherent to membrane protein expression:

  • E. coli expression systems:

    • C43(DE3) or Lemo21(DE3) strains specifically designed for membrane protein expression

    • Use of pET or pBAD vector systems with tunable promoters for controlled expression rates

    • Growth at lower temperatures (16-25°C) after induction to slow protein production and improve folding

    • Addition of specific chaperones to assist proper folding

  • Expression conditions optimization:

    • Induction at precise OD600 of 0.5-0.6

    • IPTG concentration adjusted to 0.1-1 mM depending on toxicity

    • Extended expression times (4-16 hours) at reduced temperatures

  • Alternative expression hosts:

    • Lactococcus lactis for difficult-to-express bacterial membrane proteins

    • Pichia pastoris for higher yields of properly folded membrane proteins

    • Cell-free expression systems combined with lipid nanodiscs for direct incorporation into membranes

When selecting an expression system, researchers should consider that maintaining the native structure and function of YbhR requires preserving its interactions with lipids and potentially with other components of the YbhFSR complex.

What is the role of YbhR in tetracycline resistance mechanisms?

YbhR, as part of the YbhFSR complex, contributes to tetracycline resistance through active efflux mechanisms. The YbhFSR complex has been identified to transport tetracycline, oxytetracycline, chlortetracycline, and doxycycline . Through experimental investigations using MIC assays and efflux/accumulation studies, researchers have determined that tetracyclines are likely the major antibiotic substrates of this transporter complex .

The resistance mechanism works through:

  • Recognition of tetracyclines entering the bacterial cell

  • Binding of these compounds to the transmembrane domains formed by YbhS and YbhR

  • ATP hydrolysis by YbhF providing energy for conformational changes

  • Extrusion of tetracyclines to the extracellular environment

Knockout studies have confirmed that removal of the ybhF gene (and by extension, disruption of the YbhFSR complex) increases bacterial susceptibility to tetracyclines . This indicates that YbhR plays a crucial role in the innate defense mechanism of bacteria against this class of antibiotics by participating in the formation of the transport channel through which these antibiotics are expelled.

How does YbhR substrate specificity compare to other bacterial efflux transporters?

YbhR, as part of the YbhFSR complex, demonstrates a relatively narrow substrate specificity compared to some other bacterial efflux systems:

  • YbhFSR specificity:

    • Primary substrates: Tetracyclines (tetracycline, oxytetracycline, chlortetracycline, doxycycline)

    • Secondary substrates: DNA-binding dyes (ethidium bromide, Hoechst33342)

    • Also functions as a Na+(Li+)/H+ antiporter

  • Comparison with general porins:

    • Unlike general porins such as OmpF, which allows passive diffusion of molecules up to 600 Da, YbhR is part of an active transport system with specificity for particular substrates

    • The YbhFSR complex shows greater selectivity than general porins, which have relatively little specificity

  • Comparison with other ABC transporters:

    • More specialized than multidrug ABC transporters like P-glycoprotein

    • Narrower substrate range than RND transporters like AcrAB-TolC, which can transport multiple classes of antibiotics and detergents

    • Functions primarily with tetracyclines, whereas other ABC efflux pumps may handle a broader range of substrates

The dual functionality of YbhFSR as both a drug efflux pump and an ion antiporter is a notable characteristic that distinguishes it from transporters dedicated solely to either function .

How does YbhR interact with the ATP-binding component YbhF to facilitate transport?

The interaction between YbhR and YbhF is central to the function of the YbhFSR transporter complex and follows the established ABC transporter mechanism:

  • Conformational coupling mechanism:

    • YbhF contains two nucleotide binding domains (NBDs) that bind and hydrolyze ATP

    • ATP binding induces dimerization of the NBDs

    • This conformational change is transmitted to the membrane components YbhR and YbhS

    • The resulting structural alterations in YbhR and YbhS change the accessibility of the substrate binding site, facilitating transport

  • Key interaction domains:

    • Coupling helices in YbhR likely interact with specific regions of YbhF

    • These interactions translate the energy from ATP hydrolysis into mechanical work for substrate transport

    • Conserved motifs in YbhF (Walker A, Walker B, and signature motifs) coordinate with complementary regions in YbhR

  • Transport cycle:

    • In the resting state, YbhR and YbhS form a cavity accessible from the cytoplasmic side

    • Substrate binding triggers ATP binding to YbhF

    • ATP-induced conformational changes alter YbhR orientation, creating an outward-facing conformation

    • Substrate is released, and ATP hydrolysis resets the transporter to its resting state

The ATPase activity of YbhF can be studied using the malachite green assay to measure inorganic phosphate release , providing insights into how substrate binding to YbhR might affect the ATP hydrolysis rate of YbhF.

What techniques can effectively measure the assembly and stability of the YbhFSR complex?

Multiple complementary techniques can effectively assess YbhFSR complex assembly and stability:

  • Co-purification approaches:

    • Tandem affinity purification with tags on different components

    • Size exclusion chromatography to isolate intact complexes

    • Blue native PAGE to preserve native protein-protein interactions

  • Biophysical techniques:

    • Analytical ultracentrifugation to determine stoichiometry and assembly state

    • Thermal shift assays to measure complex stability under various conditions

    • Surface plasmon resonance to quantify binding kinetics between purified components

  • Structural methods:

    • Cryo-electron microscopy to visualize the assembled complex

    • Cross-linking mass spectrometry to map interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry to identify regions involved in complex formation

  • Functional assays:

    • ATPase activity measurements to assess functional coupling between components

    • Transport assays in reconstituted proteoliposomes containing the complete complex

    • Substrate binding assays to determine how complex assembly affects substrate affinity

  • In vivo approaches:

    • Bacterial two-hybrid or split-GFP complementation to verify interactions

    • Co-immunoprecipitation from native membranes

    • FRET-based assays to monitor proximity of labeled components

When interpreting results, researchers should account for the impact of detergents on membrane protein interactions and consider reconstituting the complex in lipid nanodiscs or liposomes to better mimic the native membrane environment.

What are the best approaches for studying YbhR's dual function as part of an antiporter mechanism?

To investigate YbhR's dual functionality in both drug efflux and ion transport, researchers should employ specialized methodologies that can distinguish between these functions:

  • Ion transport measurement techniques:

    • pH-sensitive fluorescent probes to monitor proton movement

    • Na+-sensitive fluorescent indicators to measure sodium flux

    • Isotope-based assays using 22Na+ to directly quantify transport

    • Electrophysiological measurements in reconstituted membranes

  • Experimental designs for antiporter function:

    • Expression of YbhFSR in E. coli strains lacking crucial Na+/H+ transporters (e.g., E. coli KNabc) to assess salt tolerance

    • Growth assays under varying NaCl, LiCl concentrations, and pH conditions

    • Ion gradient dissipation assays in proteoliposomes containing purified complex

    • Competition assays between drug efflux and ion transport functions

  • Molecular approaches:

    • Identification and mutation of the NatA motif implicated in Na+/H+ transport

    • Creation of chimeric proteins with other known antiporters to map functional domains

    • Conformational locking through disulfide cross-linking to capture different transport states

    • FRET-based sensors to detect conformational changes during transport cycles

  • Computational modeling:

    • Molecular dynamics simulations of ion and drug binding sites

    • Pathway analysis for identifying ion translocation channels

    • Energy landscape calculations for different transport scenarios

By integrating these approaches, researchers can delineate the mechanisms underlying YbhR's dual functionality and understand how these seemingly distinct transport activities are coordinated within the same protein complex.

How can researchers design experiments to identify novel substrates for the YbhFSR complex?

Designing experiments to identify novel YbhFSR substrates requires a systematic approach combining computational prediction, high-throughput screening, and validation studies:

  • In silico prediction strategies:

    • Pharmacophore modeling based on known substrates (tetracyclines, ethidium bromide)

    • Virtual screening of compound libraries against predicted binding sites

    • Molecular docking to estimate binding energies

    • Machine learning approaches trained on known substrates and non-substrates

  • High-throughput screening methodologies:

    • Growth inhibition assays comparing wild-type and YbhFSR-deficient strains against compound libraries

    • Fluorescence-based competition assays using known fluorescent substrates

    • Membrane vesicle transport assays with candidate compounds

    • ATP consumption assays to detect stimulation of ATPase activity by potential substrates

  • Experimental validation techniques:

    • MIC determination for candidate compounds

    • Direct transport assays using radiolabeled or fluorescently labeled compounds

    • Accumulation assays in knockout versus complemented strains

    • Binding affinity measurements using purified components

  • Structural biology approaches:

    • Co-crystallization attempts with candidate substrates

    • HDX-MS to identify regions with altered dynamics upon substrate binding

    • Cryo-EM structural analysis with and without substrates

  • Optimal experimental design considerations:

    • Use of expected information gain (EIG) to prioritize experiments

    • Bayesian optimization to efficiently search the chemical space

    • Adaptive experimental design to iteratively refine the substrate profile

This comprehensive approach maximizes the probability of identifying novel substrates while minimizing resources spent on false leads.

What methodological challenges exist in studying membrane proteins like YbhR, and how can they be overcome?

Membrane proteins like YbhR present significant methodological challenges that require specialized approaches:

  • Expression and purification challenges:

    • Low expression levels

    • Protein misfolding and aggregation

    • Detergent selection complexities

    • Maintaining stability during purification

    Solutions:

    • Use specialized strains designed for membrane protein expression

    • Optimize induction conditions (temperature, inducer concentration)

    • Screen multiple detergents for solubilization efficiency

    • Employ lipid nanodiscs or amphipols for improved stability

  • Functional characterization challenges:

    • Maintaining activity outside native membrane environment

    • Distinguishing between transport and channel activities

    • Reconstituting multi-component complexes (YbhFSR)

    • Measuring vectorial transport processes

    Solutions:

    • Reconstitute in proteoliposomes with defined lipid composition

    • Develop sensitive assays for both drug efflux and ion antiport activities

    • Use complementary genetic approaches (knockouts, complementation)

    • Employ fluorescent or radioactive substrate tracking

  • Structural analysis challenges:

    • Difficulty in obtaining crystals

    • Conformational heterogeneity

    • Detergent micelle interference in structural studies

    • Limited resolution in membrane regions

    Solutions:

    • Utilize cryo-EM for structure determination without crystallization

    • Employ conformational stabilizing antibodies or nanobodies

    • Use lipid cubic phase crystallization techniques

    • Combine low-resolution structures with computational modeling

  • Interaction studies challenges:

    • Weak or transient interactions between complex components

    • Detergent interference with protein-protein interactions

    • Difficulty distinguishing specific from non-specific interactions

    Solutions:

    • Cross-linking strategies to capture transient interactions

    • Native mass spectrometry with specialized detergents

    • In vivo interaction assays (FRET, BiFC, PLA)

    • Genetic complementation approaches

By implementing these methodological solutions, researchers can overcome the inherent challenges of working with membrane proteins like YbhR and obtain reliable, biologically relevant data.

How should researchers interpret conflicting data about YbhR function in different experimental systems?

When faced with conflicting data regarding YbhR function across different experimental systems, researchers should adopt a systematic interpretive framework:

  • Evaluate experimental context differences:

    • Expression system variations (E. coli strains, expression levels)

    • Membrane composition differences (native versus artificial)

    • Presence or absence of other complex components (YbhF, YbhS)

    • Buffer conditions, especially ion concentrations that could affect antiporter function

  • Assess methodological considerations:

    • Direct versus indirect measurement approaches

    • Sensitivity and specificity of detection methods

    • Time scales of experiments (transient versus steady-state measurements)

    • Potential artifacts introduced by tags or fusion proteins

  • Reconciliation strategies:

    • Determine if conflicting results represent different aspects of a multifunctional protein

    • Consider alternative models that explain all observations

    • Perform bridging experiments that connect different experimental systems

    • Develop mathematical models that incorporate context-dependent behavior

  • Validation approaches:

    • Design critical experiments that can distinguish between competing models

    • Repeat key experiments across multiple systems to identify consistent behaviors

    • Use orthogonal methods to confirm central findings

    • Collaborate with labs using different approaches to verify results

  • Reporting recommendations:

    • Clearly describe all experimental conditions

    • Acknowledge limitations of each approach

    • Present alternative interpretations of the data

    • Suggest specific experiments that could resolve discrepancies

By following this framework, researchers can move beyond seeing conflicting data as problematic to recognizing it as an opportunity to develop a more nuanced understanding of YbhR's complex functions.

What statistical approaches are most appropriate for analyzing transporter kinetics data from YbhR studies?

For rigorous analysis of YbhR transporter kinetics, researchers should employ specialized statistical approaches:

  • Kinetic model selection and fitting:

    • Compare multiple transport models (simple Michaelis-Menten, Hill equation, two-site models)

    • Use Akaike Information Criterion (AIC) or Bayesian Information Criterion (BIC) for model selection

    • Apply global fitting approaches when analyzing multiple datasets simultaneously

    • Employ Bayesian parameter estimation for complex models with many parameters

  • Time-series data analysis:

    • Compartmental modeling for substrate accumulation/efflux data

    • Deconvolution techniques to separate overlapping processes

    • Non-linear mixed-effects models for experiments with multiple replicates

    • Auto-regressive integrated moving average (ARIMA) models for fluctuating time-series data

  • Handling experimental variability:

    • Hierarchical models to account for batch effects

    • Bootstrap resampling to generate confidence intervals

    • Variance stabilizing transformations for heteroscedastic data

    • Power analysis to determine appropriate sample sizes

  • Optimal experimental design application:

    • Expected information gain (EIG) calculations to prioritize experiments

    • Sequential design approaches that adapt based on accumulated data

    • D-optimal or E-optimal designs for parameter estimation efficiency

    • Simulation-based power calculations for complex experimental designs

  • Software and implementation recommendations:

    • DynaFit or KinTek Explorer for mechanism-based kinetic modeling

    • R packages (drc, nlme) for dose-response and nonlinear mixed effects models

    • PyMC3 or Stan for Bayesian parameter estimation

    • Custom simulation-based approaches for complex transport mechanisms

By applying these statistical approaches, researchers can extract maximum information from kinetic data, properly account for uncertainty, and make statistically robust comparisons between different experimental conditions.

How can researchers integrate structural predictions with functional data to develop comprehensive models of YbhR activity?

Integrating structural predictions with functional data creates a powerful approach for developing comprehensive models of YbhR activity:

This integrative approach leverages the complementary nature of structural and functional data to develop mechanistic models with greater predictive power than either approach alone could provide.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.