Recombinant Inner membrane transport permease yhhJ (yhhJ)

Shipped with Ice Packs
In Stock

Description

Role in Heme and Peptide Transport

  • yhhJ is implicated in the DppBCDF transporter complex, which facilitates heme and dipeptide uptake in E. coli .

  • Despite E. coli K12’s inability to use exogenous heme, recombinant strains expressing yhhJ can transport heme iron when paired with periplasmic binding proteins (DppA or MppA) .

  • Competitive binding between heme and peptides occurs at DppA/MppA, suggesting overlapping substrate recognition .

Association with Drug Resistance

  • yhhJ is part of a putative ABC transporter cluster (yhiH-yhhJ) linked to uncharacterized drug efflux mechanisms .

  • Overexpression studies indicate potential roles in multidrug resistance, though specific substrates remain unidentified .

Research Applications

  • Mechanistic studies: Used to investigate ABC transporter dynamics and substrate specificity .

  • Heme uptake models: Serves as a tool to study iron acquisition pathways in Gram-negative bacteria .

  • Drug discovery: Explored for novel antibiotic targets due to its role in membrane transport .

Key Research Findings

  • Heme binding: DppA (a partner protein of yhhJ) shares structural homology with Haemophilus influenzae heme-binding protein HbpA .

  • Genetic context: yhhJ is co-expressed with regulatory genes (yhiI/H) in putative drug efflux operons .

  • Industrial relevance: Recombinant yhhJ aids in membrane protein studies due to its stability in cell-free systems .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type preferences, please inform us, and we will prioritize the development of the specified tag.
Synonyms
yhhJ; SF3501; S4262; Inner membrane transport permease YhhJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-374
Protein Length
full length protein
Species
Shigella flexneri
Target Names
yhhJ
Target Protein Sequence
MRHLRNIFNLGIKELRSLLGDKAMLTLIVFSFTVSVYSSATVTPGSLNLAPIAIADMDQS QLSNRIVNSFYRPWFLPPEMITADEMDAGLDAGRYTFAINIPPNFQRDVLAGRQPDIQVN VDATRMSQAFTGNGYIQNIINGEVNSFVARYRDNSEPLVSLETRMRFNPNLDPAWFGGVM AIINNITMLAIVLTGSALIREREHGTVEHLLVMPITPFEIMMAKIWSMGLVVLVVSGLSL VLMVKGVLGVPIEGSIPLFMLGVALSLFATTSIGIFMGTIARSMPQLGLLVILVLLPLQM LSGGSTPRESMPQMVQDIMLTMPTTHFVSLAQAILYRGAGFEIVWPQFLTLMAIGGAFFT IALLRFRKTIGTMA
Uniprot No.

Target Background

Database Links

KEGG: sfl:SF3501

Protein Families
ABC-2 integral membrane protein family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is yhhJ and what cellular functions does it perform?

Inner membrane transport permease yhhJ is a transmembrane protein belonging to the family of transport permeases that facilitate the movement of specific substrates across the cell membrane. The protein is characterized by multiple membrane-spanning domains that create a channel or pore through which substrates can pass. While specific substrate specificity for yhhJ has not been fully characterized, it appears to be involved in nutrient transport across bacterial inner membranes, potentially playing a role in cellular metabolism and homeostasis. Like other recombinant proteins, yhhJ can be produced through genetic engineering by inserting the specific gene of interest into a host organism for subsequent expression .

How is recombinant yhhJ typically expressed and purified for research applications?

Recombinant yhhJ, like other membrane proteins, requires specialized expression systems due to its hydrophobic nature and membrane integration requirements. The typical expression protocol involves:

  • Gene cloning into an appropriate expression vector with a strong promoter and affinity tag

  • Transformation into a suitable expression host (often E. coli BL21(DE3) for initial attempts)

  • Growth in rich media supplemented with appropriate antibiotics until optimal density

  • Induction of protein expression with IPTG or another inducer

  • Cell harvesting by centrifugation

  • Membrane isolation through differential centrifugation

  • Solubilization using detergents compatible with membrane proteins

  • Purification using affinity chromatography based on the fusion tag

  • Optional reconstitution into liposomes or nanodiscs for functional studies

This methodology is similar to approaches used for other membrane proteins and transport permeases. The expression system often requires optimization of growth conditions, inducer concentration, and expression time to maximize protein yield while ensuring proper folding .

What expression systems are most effective for producing functional recombinant yhhJ?

The selection of an appropriate expression system is critical for obtaining functional recombinant yhhJ. Based on research with similar membrane proteins, several expression systems have shown promise:

  • Bacterial systems: E. coli remains the first-choice expression host due to its rapid growth, well-established genetic tools, and cost-effectiveness. The BL21(DE3) strain is commonly used with tightly controlled promoters like T7. For membrane proteins like yhhJ, E. coli strains C41(DE3) and C43(DE3), which are specifically designed for membrane protein expression, may provide better results .

  • Yeast systems: Pichia pastoris (Komagataella phaffii) offers advantages for membrane protein expression, including proper folding machinery and the ability to grow to high cell density.

  • Insect cell systems: Baculovirus-infected insect cells provide a eukaryotic environment that can be beneficial for complex membrane proteins with post-translational modifications.

  • Mammalian cell systems: For human proteins or proteins requiring specific mammalian cellular machinery, HEK293 or CHO cells may be necessary.

The choice depends on research objectives, budget constraints, and the specific properties of yhhJ being investigated. Optimization may involve testing different promoters, signal sequences, and fusion partners to enhance expression levels and functionality .

What are the most effective strategies for determining the substrate specificity of yhhJ?

Determining substrate specificity for inner membrane transporters like yhhJ requires a multi-faceted approach:

  • Bioinformatic analysis: Sequence comparison with characterized transporters can provide initial clues about potential substrates. Structural predictions and phylogenetic analysis may reveal conserved binding motifs.

  • Genetic approaches:

    • Gene knockout studies to observe phenotypic changes

    • Complementation assays in knockout strains with wild-type and mutant versions

    • Growth assays with different carbon or nitrogen sources to identify conditions where yhhJ is essential

  • Biochemical approaches:

    • Direct binding assays with radiolabeled potential substrates

    • Transport assays using purified protein reconstituted in liposomes or proteoliposomes

    • Isothermal titration calorimetry (ITC) to measure binding affinities

    • Surface plasmon resonance (SPR) for interaction kinetics

  • Structural methods:

    • X-ray crystallography or cryo-EM with and without bound substrates

    • Hydrogen-deuterium exchange mass spectrometry to identify conformational changes upon substrate binding

  • High-throughput screening:

    • Fluorescence-based transport assays with libraries of potential substrates

    • Metabolomic profiling comparing wild-type and knockout strains

This systematic approach often requires iteration between multiple methods to confidently identify and validate the natural substrates of yhhJ .

How can researchers troubleshoot issues with yhhJ protein stability during purification?

Membrane proteins like yhhJ present unique challenges during purification. When encountering stability issues, researchers should consider the following troubleshooting approaches:

  • Detergent optimization:

    • Test multiple detergent types (mild non-ionic, zwitterionic, etc.)

    • Create a detergent screen (DDM, LMNG, OG, CHAPS, etc.) at various concentrations

    • Consider detergent mixtures for improved stability

    • Implement detergent exchange during purification steps

  • Buffer optimization:

    • Screen pH ranges (typically 6.0-8.0) to identify optimal stability conditions

    • Test various salt concentrations (typically 100-500 mM NaCl)

    • Add stabilizing agents (glycerol, specific lipids, cholesterol)

    • Include reducing agents if cysteine residues are present

  • Lipid supplementation:

    • Add specific phospholipids that may be required for stability

    • Consider nanodiscs or lipid cubic phase for native-like environment

    • Use lipid-detergent mixed micelles

  • Temperature considerations:

    • Perform all purification steps at 4°C

    • Test protein stability at different temperatures

    • Consider rapid purification to minimize exposure time

  • Protein engineering approaches:

    • Introduce stabilizing mutations based on computational prediction

    • Create fusion constructs with stability-enhancing partners

    • Remove flexible regions that may cause aggregation

  • Monitoring methods:

    • Use size-exclusion chromatography to assess monodispersity

    • Implement thermal shift assays to quantify stability improvements

    • Apply dynamic light scattering to detect aggregation

Systematic documentation of conditions and outcomes is essential for optimization. Researchers should consider implementing high-throughput methods to screen multiple conditions simultaneously .

What are the current challenges in determining the structure of yhhJ and how can they be addressed?

Determining the structure of membrane transport proteins like yhhJ presents several significant challenges:

  • Expression and purification obstacles:

    • Limited protein yield due to toxicity to host cells

    • Difficulty maintaining native conformation during extraction

    • Protein aggregation during concentration steps

    Solutions: Utilize specialized expression strains, optimize detergent conditions, and implement mild purification protocols with minimal concentration steps.

  • Conformational heterogeneity:

    • Transporters often exist in multiple conformational states

    • Dynamic nature complicates structural studies

    Solutions: Use conformation-specific antibodies or nanobodies, employ mutations that lock specific conformations, or analyze multiple states through computational methods.

  • Crystallization difficulties:

    • Detergent micelles interfere with crystal contacts

    • Limited polar surface area for crystal formation

    Solutions: Implement lipidic cubic phase crystallization, use crystallization chaperones, or explore fragment-based crystallography.

  • Cryo-EM challenges:

    • Small size of membrane proteins reduces signal-to-noise ratio

    • Preferential orientation in vitreous ice

    Solutions: Use larger fusion partners, implement tilted data collection, or use specialized grids to overcome preferred orientation.

  • Data analysis complexities:

    • Phase determination in crystallography

    • Model building with limited resolution

    Solutions: Employ heavy atom derivatives, molecular replacement with homologous structures, or integrate multiple structural methods.

  • Validation concerns:

    • Confirming physiological relevance of observed structures

    • Distinguishing functional from artifactual conformations

    Solutions: Combine structural data with functional assays, mutagenesis studies, and computational simulations.

Recent advances in technology, particularly in single-particle cryo-EM and computational methods, are helping to address these challenges. Integration of structural biology with functional studies remains essential for meaningful interpretation of structural data .

How can researchers establish reliable functional assays for yhhJ transport activity?

Establishing functional assays for membrane transporters like yhhJ requires careful consideration of the protein's natural environment and transport mechanism. The following approaches can be implemented:

  • Whole-cell transport assays:

    • Comparison of substrate uptake between wild-type and yhhJ knockout strains

    • Complementation with plasmid-encoded yhhJ to confirm specificity

    • Monitoring growth phenotypes in media where transport function is essential

    Methodology: Cells are grown to mid-log phase, washed, and resuspended in appropriate buffer. Substrate (potentially radiolabeled) is added, and samples are taken at intervals. Cells are rapidly filtered and washed, and accumulated substrate is measured.

  • Reconstituted proteoliposome assays:

    • Purified yhhJ reconstituted into liposomes with controlled lipid composition

    • Inside-out or right-side-out vesicle preparation depending on transport direction

    • Substrate transport measured by fluorescence, radioactivity, or coupled enzyme assays

    Methodology: Liposomes containing purified yhhJ are prepared by detergent removal methods. Substrate transport is initiated by creating a concentration gradient and measured using appropriate detection methods.

  • Electrophysiological measurements:

    • Patch-clamp recordings for transporters with electrogenic activity

    • Solid-supported membrane (SSM)-based electrophysiology

    Methodology: Protein is reconstituted into giant unilamellar vesicles or planar lipid bilayers, and currents associated with transport activity are measured.

  • Binding assays as proxies for transport:

    • Microscale thermophoresis to measure substrate binding affinities

    • Tryptophan fluorescence quenching upon substrate binding

    • Isothermal titration calorimetry for thermodynamic parameters

    Methodology: Purified protein in detergent micelles or nanodiscs is titrated with potential substrates, and binding parameters are calculated from the resulting data.

  • pH or ion-sensitive fluorescent probes:

    • For transporters coupled to H+ or other ion gradients

    • Real-time monitoring of transport-associated pH changes

    Methodology: Fluorescent pH-sensitive dyes are entrapped in proteoliposomes, and fluorescence changes upon transport activation are recorded.

Validation of assay specificity through controls, including inactive mutants and specificity for the presumed substrate, is essential for reliable functional characterization .

What approaches can be used to identify potential interaction partners of yhhJ?

Identifying protein-protein interactions (PPIs) for membrane proteins like yhhJ requires specialized techniques that can maintain the native membrane environment while enabling detection of transient or stable interactions:

  • Affinity-based methods:

    • Tandem affinity purification (TAP): Dual-tagged yhhJ is expressed in the native organism, allowing sequential purification steps to identify associated proteins

    • Co-immunoprecipitation (Co-IP): Antibodies against yhhJ or its epitope tag are used to pull down protein complexes

    • Pull-down assays: Recombinant tagged yhhJ is used as bait to identify binding partners from cellular lysates

  • Proximity-based labeling:

    • BioID: A biotin ligase fused to yhhJ biotinylates nearby proteins, which are then identified by streptavidin purification and mass spectrometry

    • APEX2: An engineered peroxidase fused to yhhJ catalyzes biotinylation of proximal proteins upon addition of biotin-phenol and H₂O₂

    • TurboID: An evolved biotin ligase with faster kinetics for shorter labeling times

  • Genetic and genomic approaches:

    • Bacterial two-hybrid systems: Modified for membrane protein analysis

    • Genetic suppressor screens: Identification of mutations that suppress yhhJ mutant phenotypes

    • Synthetic genetic arrays: Systematic genetic interaction mapping to identify functional relationships

  • Structural approaches:

    • Chemical cross-linking coupled with mass spectrometry: Identifies proteins in close proximity to yhhJ

    • Cryo-electron tomography: Visualizes protein complexes in their native cellular context

    • FRET-based assays: Detects proximity between fluorescently labeled proteins

  • Computational prediction:

    • Machine learning approaches: Trained on known membrane protein interactions

    • Network analysis: Identifies potential interactors based on functional associations

    • Co-evolution analysis: Identifies proteins that show coordinated evolutionary changes

  • Validation methods:

    • Bimolecular fluorescence complementation (BiFC): Visualizes protein interactions in living cells

    • Förster resonance energy transfer (FRET): Measures energy transfer between fluorophores on interacting proteins

    • Surface plasmon resonance (SPR): Quantifies binding kinetics between purified proteins

When reporting interaction data, it's important to classify interactions as direct (physical) or indirect (functional) and to assess the biological relevance through additional functional studies .

How can researchers accurately determine the membrane topology of yhhJ?

Determining the membrane topology of transport proteins like yhhJ is crucial for understanding their function. Multiple complementary approaches should be used to build a reliable topological model:

  • Computational prediction methods:

    • Hydropathy analysis to identify transmembrane segments

    • Machine learning algorithms trained on known membrane protein structures

    • Consensus approach using multiple prediction tools (TMHMM, TOPCONS, Phobius, etc.)

    Reliability assessment: Compare predictions from multiple algorithms and assess consistency.

  • Biochemical methods:

    • Substituted cysteine accessibility method (SCAM): Sequential cysteine substitutions combined with membrane-permeable and impermeable thiol-reactive reagents

    • Protease protection assays: Limited proteolysis of intact membrane vesicles vs. permeabilized membranes

    • Glycosylation mapping: Introduction of glycosylation sites to report on lumenal exposure

    Methodology table:

    MethodPrincipleAdvantagesLimitations
    SCAMAccessibility of engineered cysteines to thiol reagentsHigh resolution, works in native membranesRequires functional cysteine-less variant
    Protease protectionDifferential proteolysis based on membrane accessibilitySimple, doesn't require protein engineeringLow resolution, requires specific antibodies
    Glycosylation mappingN-glycosylation occurs only in lumen/extracellular spaceWorks in vivo, clear readoutRequires eukaryotic expression system
  • Fluorescence-based approaches:

    • GFP-fusion analysis: C-terminal GFP fusions report on cytoplasmic or periplasmic orientation

    • pH-sensitive fluorescent proteins: Differential fluorescence based on cellular compartment pH

    • Förster resonance energy transfer (FRET): Measure distances between domains

  • Genetic fusion approaches:

    • Reporter gene fusions: β-lactamase, alkaline phosphatase, or other reporters with activity dependent on cellular location

    • Complementation-based methods: Split-protein complementation assays across membrane

  • Structural methods:

    • Cryo-electron microscopy: Direct visualization of transmembrane helices

    • X-ray crystallography: Atomic-resolution structure determination

    • Electron paramagnetic resonance (EPR) spectroscopy: Spin-labeled residues provide accessibility information

  • Chemical crosslinking:

    • Site-specific crosslinking to map proximity relationships

    • Mass spectrometry analysis of crosslinked peptides

The most robust topological models integrate data from multiple methods. Discrepancies between methods should be systematically investigated rather than dismissed, as they may reveal dynamic aspects of the protein's structure .

How can researchers identify and analyze potential inconsistencies in yhhJ functional data?

When analyzing functional data for membrane transporters like yhhJ, researchers may encounter inconsistencies that require systematic analysis:

  • Common sources of data inconsistencies:

    • Different expression systems affecting protein folding and post-translational modifications

    • Varied lipid environments altering transporter kinetics

    • Detergent effects on protein conformation and activity

    • Differing buffer conditions (pH, ionic strength, temperature)

    • Presence of contaminants or co-purifying proteins influencing activity

    • Variability in protein-to-lipid ratio in reconstituted systems

  • Analytical framework for inconsistency resolution:

    • Comprehensive experimental metadata documentation

    • Statistical analysis of replicate experiments

    • Correlation analysis between experimental conditions and outcomes

    • Application of knowledge graph analysis to identify logical contradictions

  • Knowledge graph analysis approach:

    • Create formalized representations of experimental findings

    • Apply logical inference rules to detect contradictions

    • Identify minimal sets of contradicting statements (anti-patterns)

    • Quantify the prevalence of specific contradiction types

  • Practical steps for resolving inconsistencies:

    • Conduct controlled experiments varying only one parameter at a time

    • Implement internal controls within each experiment

    • Validate findings using complementary methodologies

    • Perform independent replications in different laboratories

    • Consider time-dependent changes in protein stability

  • Data integration strategies:

    • Bayesian analysis to incorporate prior knowledge

    • Meta-analysis of multiple datasets with random or fixed-effects models

    • Machine learning approaches to identify patterns in complex datasets

When inconsistencies are identified, researchers should distinguish between technical artifacts and biologically meaningful variations that may reveal important regulatory mechanisms or context-dependent functions of yhhJ .

What are the best practices for designing site-directed mutagenesis experiments to study yhhJ function?

Site-directed mutagenesis is a powerful approach for investigating structure-function relationships in membrane transporters like yhhJ. Effective experimental design follows these best practices:

  • Strategic selection of residues for mutation:

    • Conserved residues identified through multiple sequence alignment

    • Residues predicted to line substrate binding sites or translocation pathways

    • Charged or polar residues within transmembrane regions (often functionally important)

    • Residues at domain interfaces or potential conformational hinges

    • Positions implicated by available structural information on homologous proteins

  • Types of mutations and their applications:

    Mutation TypePurposeExample Application
    ConservativeMaintain chemical properties while testing specific interactionsLeu → Ile to test steric effects
    Non-conservativeDisrupt specific interactionsAsp → Asn to eliminate charge
    Alanine scanningSystematic removal of side chainsSequential Ala substitution through binding site
    Cysteine scanningProbe accessibility and for disulfide crosslinkingSCAM analysis of translocation pathway
    Charge reversalTest electrostatic interactionsLys → Glu to reverse charge
    Introduction of reporter groupsSite-specific probesTrp introduction for fluorescence studies
  • Control experiments:

    • Verification of expression levels through Western blotting

    • Assessment of membrane localization through fractionation or imaging

    • Protein stability analysis via thermal shift assays

    • Testing of multiple mutations of the same residue to distinguish effects

    • Wild-type controls processed in parallel with mutants

  • Functional assays for mutants:

    • Transport kinetics (Km, Vmax) to distinguish binding from translocation effects

    • Substrate specificity profiles to identify binding site alterations

    • pH dependence to probe proton coupling mechanisms

    • Temperature dependence to assess effects on protein dynamics

    • Inhibitor sensitivity to map binding sites

  • Interpretation frameworks:

    • Correlation of multiple functional parameters

    • Integration with structural models or simulations

    • Statistical analysis of mutation effects across multiple positions

    • Comparison with homologous transporters

  • Advanced approaches:

    • Suppressor mutation analysis to identify compensatory changes

    • Double-mutant cycle analysis to quantify energetic coupling

    • Unnatural amino acid incorporation for precise chemical modification

    • In vivo complementation assays to assess physiological relevance

When designing mutagenesis experiments, researchers should consider both the impact on specific functions and potential allosteric effects that may propagate through the protein structure .

How can researchers effectively combine structural predictions and experimental data to model yhhJ transport mechanisms?

Integrating computational predictions with experimental data enables comprehensive modeling of membrane transport mechanisms for proteins like yhhJ:

  • Hierarchical modeling workflow:

    • Secondary structure prediction and refinement using experimental constraints

    • Transmembrane topology modeling validated by biochemical data

    • Homology modeling based on structurally characterized transporters

    • Refinement with experimental distance constraints

    • Molecular dynamics simulations to explore conformational dynamics

    • Transport cycle modeling incorporating kinetic data

  • Integrating diverse experimental data types:

    Data TypeComputational IntegrationModeling Contribution
    Mutation effectsConstraint-based refinementFunctional site identification
    Crosslinking distancesDistance restraintsDomain orientation
    Accessibility dataSolvent exposure filtersTopology validation
    HDX-MS dataConformational flexibility guidesDynamic regions identification
    Transport kineticsTransition rate parameterizationEnergy landscape mapping
    EPR/DEER measurementsLong-range distance constraintsConformational state validation
  • Advanced computational approaches:

    • Enhanced sampling methods (metadynamics, umbrella sampling) to overcome energy barriers

    • Coarse-grained simulations for extended timescale events

    • Markov state modeling to extract kinetic information

    • Machine learning for pattern recognition in simulation data

    • Quantum mechanics/molecular mechanics (QM/MM) for substrate binding specificity

  • Transport mechanism hypothesis testing:

    • Generate alternative mechanistic models (e.g., alternating access, elevator mechanism)

    • Simulate observable consequences of each model

    • Design experiments to discriminate between models

    • Iterative refinement based on new experimental data

  • Visualization and analysis framework:

    • Transport pathway identification and characterization

    • Water molecule and ion tracking through simulations

    • Energy profile calculation along transport coordinates

    • Correlation analysis to identify allosteric networks

    • Principal component analysis to identify major conformational modes

  • Model validation approaches:

    • Prediction of mutation phenotypes not used in model construction

    • Cross-validation with newly generated experimental data

    • Comparison with homologous transporters' mechanisms

    • Consistency checks across multiple simulation repeats

The most successful transport mechanism models for membrane proteins like yhhJ emerge from iterative cycles of computational prediction, experimental testing, model refinement, and further experimental validation .

What are the optimal approaches for reconstituting yhhJ into artificial membrane systems for functional studies?

Reconstitution of membrane transporters like yhhJ into artificial membrane systems requires careful consideration of lipid composition, protein orientation, and system stability. The following methodologies provide optimal approaches:

  • Proteoliposome preparation methods:

    • Detergent-mediated reconstitution: Most common approach involving detergent solubilization of lipids, protein incorporation, and detergent removal

    • Direct incorporation: Suitable for detergent-sensitive proteins using preformed liposomes

    • Mechanical methods: Sonication or extrusion to control vesicle size and lamellarity

  • Detergent removal strategies:

    MethodPrincipleAdvantagesLimitationsBest Applications
    DialysisDiffusion across membraneGentle, controlled rateSlow, inefficient for some detergentsSmall-scale, mild detergents
    Bio-BeadsHydrophobic adsorptionFast, efficientPotential protein adsorptionLarge-scale, most detergents
    CyclodextrinComplex formationPrecise controlExpensive, limited detergent rangeKinetic studies, rapid removal
    DilutionConcentration below CMCSimpleIncomplete removal, dilute samplesPreliminary screening
    Gel filtrationSize-based separationClean preparationSample dilutionFinal purification step
  • Lipid composition optimization:

    • Systematic testing of lipid headgroups (PC, PE, PG, PS, cardiolipin)

    • Acyl chain length and saturation variations

    • Cholesterol or ergosterol incorporation for membrane fluidity modulation

    • Native lipid extract incorporation for physiological relevance

    • Use of fluorescent lipids for quality control and quantification

  • Alternative membrane mimetic systems:

    • Nanodiscs: Discoidal lipid bilayers stabilized by membrane scaffold proteins

    • Lipid cubic phases: 3D continuous lipid bilayer systems

    • Amphipols: Amphipathic polymers that wrap around membrane proteins

    • Styrene-maleic acid lipid particles (SMALPs): Native nanodiscs extracted directly from membranes

  • Quality control methods:

    • Dynamic light scattering for size distribution analysis

    • Freeze-fracture electron microscopy for morphological characterization

    • Fluorescence correlation spectroscopy for protein incorporation efficiency

    • Cryo-electron microscopy for direct visualization

    • Sucrose density gradient centrifugation for separation of empty liposomes

  • Functional validation approaches:

    • Transport assays with fluorescent substrates or coupled enzyme systems

    • Patch-clamp electrophysiology for single-transporter measurements

    • Stopped-flow spectroscopy for rapid kinetic measurements

    • Solid-supported membrane electrophysiology for ensemble measurements

For optimal results, researchers should systematically test multiple reconstitution conditions and validate protein orientation and activity using complementary approaches .

How can researchers effectively apply hydrogen-deuterium exchange mass spectrometry (HDX-MS) to study yhhJ dynamics?

Hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers valuable insights into membrane protein dynamics and can be effectively applied to study yhhJ conformational changes:

  • Experimental design considerations for membrane proteins:

    • Selection of appropriate detergent or membrane mimetic system

    • Optimization of protein-to-lipid/detergent ratio

    • Control of back-exchange during sample processing

    • Temperature optimization for exchange rates

    • Time-course design to capture relevant dynamics

  • Sample preparation workflow:

    • Purification in detergent micelles or reconstitution in nanodiscs

    • Equilibration in H₂O buffer

    • Initiation of exchange by dilution into D₂O buffer

    • Quenching at various timepoints by pH reduction and temperature decrease

    • Proteolytic digestion under quench conditions

    • Rapid LC-MS analysis to minimize back-exchange

  • Analytical approach for membrane transporters:

    Analysis StageMethodologySpecific Considerations for yhhJ
    Peptide mappingOptimized digestion with pepsin or other acid-stable proteasesMembrane domains may require extended digestion times
    HDX rate analysisMathematical modeling of exchange kineticsCorrection for deuterium recovery in hydrophobic regions
    Differential analysisComparison between conditions (e.g., with/without substrate)Statistical framework for significance assessment
    Data visualizationHeat maps on structural modelsIntegration with topology models if structure unknown
    Conformational clusteringIdentification of cooperatively exchanging regionsCorrelation with functional domains and transport mechanism
  • Advanced HDX-MS applications for transporters:

    • Mapping substrate binding-induced conformational changes

    • Identifying allosteric communication networks

    • Characterizing conformational transitions during transport cycle

    • Detecting effects of lipid composition on protein dynamics

    • Measuring effects of mutations on protein stability and dynamics

  • Integration with computational methods:

    • Molecular dynamics simulations to interpret exchange patterns

    • Prediction of protection factors from structural models

    • Correlation of experimental HDX rates with simulated dynamics

    • Construction of Markov state models informed by HDX data

  • Technical challenges and solutions:

    • Limited sequence coverage in hydrophobic regions: Use of multiple proteases

    • Deuterium scrambling during fragmentation: Implementation of electron transfer dissociation

    • Back-exchange during analysis: Optimized rapid LC-MS workflows

    • Data analysis complexity: Specialized software packages

HDX-MS provides complementary information to other structural techniques and is particularly valuable for capturing the dynamic aspects of membrane transport processes that may not be evident in static structural studies .

What are the most effective approaches for studying the energetics of substrate transport by yhhJ?

Understanding the energetics of substrate transport by membrane proteins like yhhJ requires integration of multiple experimental and computational approaches:

  • Thermodynamic measurements:

    • Isothermal titration calorimetry (ITC): Directly measures enthalpy (ΔH), entropy (ΔS), and binding affinity (Kd) of substrate interactions

    • Differential scanning calorimetry (DSC): Assesses protein stability changes upon substrate binding

    • Surface plasmon resonance (SPR): Provides kinetic and equilibrium binding parameters

    • Microscale thermophoresis (MST): Measures binding energetics in solution with minimal sample consumption

  • Transport energetics quantification:

    ApproachMeasurementAdvantagesLimitations
    Ion gradient dissipationΔpH, ΔΨ coupling ratiosDirectly measures energy couplingRequires specific probes or electrodes
    Counterflow assaysExchange stoichiometryReveals transport mechanismLimited to exchange mode
    Binding vs. transport comparisonEfficiency couplingDistinguishes binding from translocationRequires multiple assays
    Temperature dependenceActivation energy (Ea)Reveals rate-limiting stepsComplex interpretation for multi-step processes
    Pressure perturbationVolume changes (ΔV)Detects conformational transitionsSpecialized equipment required
  • Computational energetics methods:

    • Free energy calculations: Potential of mean force (PMF) along transport coordinate

    • Transition path sampling: Identification of energetically favorable transport pathways

    • Targeted molecular dynamics: Forced sampling of conformational changes

    • Markov state modeling: Extraction of kinetic and thermodynamic parameters from simulation data

    • Machine learning approaches: Prediction of energetic costs based on sequence/structure features

  • Experimental validation of energy coupling:

    • Measurement of proton/ion coupling stoichiometry

    • Assessment of electrogenicity through voltage-dependent assays

    • Monitoring of ATP hydrolysis rates for ATP-dependent transporters

    • Determination of transport stoichiometry through simultaneous flux measurements

    • Evaluation of thermodynamic driving forces required for transport

  • Advanced biophysical approaches:

    • Single-molecule FRET: Direct observation of conformational changes during transport

    • Electrical recording of transporters: Current measurements in artificial bilayers

    • Time-resolved spectroscopy: Detection of transient intermediates

    • Stopped-flow spectroscopy: Measurement of fast conformational changes

  • Integration framework for energetic models:

    • Construction of free energy landscapes across transport cycle

    • Identification of rate-limiting steps in the transport process

    • Correlation of structural changes with energy barriers

    • Development of kinetic models incorporating measured parameters

Understanding transport energetics is critical for developing mechanistic models of yhhJ function and may inform strategies for modulating transport activity through mutation or small molecule interactions .

How can computational approaches be used to predict substrate specificity for yhhJ?

Computational methods offer powerful tools for predicting substrate specificity of membrane transporters like yhhJ, especially when experimental data is limited:

  • Sequence-based prediction approaches:

    • Multiple sequence alignment analysis: Identification of conserved binding site residues

    • Hidden Markov Models (HMMs): Classification based on sequence patterns

    • Machine learning algorithms: Random forests, support vector machines, or neural networks trained on known transporter-substrate pairs

    • Specificity-determining position (SDP) analysis: Identification of residues that correlate with substrate preferences

  • Structure-based prediction methods:

    • Homology modeling: Construction of 3D models based on structurally characterized homologs

    • Molecular docking: Virtual screening of potential substrates against binding site models

    • Molecular dynamics simulations: Evaluation of substrate stability in binding sites

    • Binding free energy calculations: Ranking of substrate affinities

  • Combined approaches framework:

    ApproachImplementationAdvantagesLimitations
    Template-based modelingIdentify closest structural homologs for modelingLeverages known structuresDepends on template availability
    Binding site predictionCavity detection and conservation analysisCan work with lower-quality modelsMay miss cryptic binding sites
    Virtual screeningDocking of metabolite librariesComprehensive substrate space explorationScoring function limitations
    Dynamic analysisMD simulations of protein-substrate complexesAccounts for induced fitComputationally expensive
    ML-based predictionIntegration of sequence and structural featuresCan identify non-obvious patternsRequires training data
  • Substrate library preparation strategies:

    • Curation of metabolite databases (HMDB, ChEBI, KEGG)

    • Filtering by physicochemical properties relevant to transporters

    • Generation of tautomers and protonation states

    • Conformer sampling for flexible molecules

    • Focused libraries based on metabolic context

  • Validation and refinement approach:

    • Pharmacophore model development based on predicted substrates

    • In silico mutagenesis to assess effects on substrate binding

    • Consensus scoring across multiple methods

    • Experimental testing of top-ranked predictions

    • Iterative refinement based on experimental feedback

  • Advanced methods for membrane transporter specificity:

    • Path-finding algorithms to identify substrate translocation routes

    • Quantum mechanics calculations for specific chemical interactions

    • Coarse-grained simulations for complete transport cycles

    • Graph-based representations of substrate chemical similarity

    • Network analysis of transporter-substrate relationships

These computational approaches can guide experimental efforts by prioritizing potential substrates for biochemical testing, helping to overcome the challenges in experimentally screening large compound libraries with membrane transporters like yhhJ .

What are the emerging techniques that could advance our understanding of yhhJ structure and function?

Several cutting-edge techniques are emerging that could significantly advance our understanding of membrane transporters like yhhJ:

  • Advanced structural biology methods:

    • Cryo-electron tomography (cryo-ET): Visualizing transporters in their native membrane environment

    • Micro-electron diffraction (microED): Structure determination from nanocrystals

    • Serial femtosecond crystallography (SFX): Room-temperature structures using X-ray free-electron lasers

    • Integrative structural biology: Combining multiple experimental data types with computational modeling

  • Single-molecule approaches:

    • Single-molecule FRET (smFRET): Detecting conformational dynamics in real-time

    • High-speed atomic force microscopy (HS-AFM): Direct visualization of structural changes

    • Nanopore-based electrical recording: Measuring single transporter activity

    • Zero-mode waveguides: Optical confinement for single-molecule detection in high concentrations

  • Emerging genetic and cellular techniques:

    TechniqueApplication to yhhJ ResearchPotential Insights
    CRISPR-based screeningSystematic functional genomicsIdentification of genetic interactions and regulatory networks
    Ribosome profilingTranslation regulation analysisUnderstanding expression control mechanisms
    Proximity labeling (TurboID, APEX)In vivo interaction mappingIdentification of transient interaction partners and complexes
    Single-cell transcriptomicsExpression pattern analysisCellular contexts for transporter function
    Deep mutational scanningComprehensive mutation effectsStructure-function relationships at unprecedented scale
  • Advanced spectroscopic methods:

    • Electron paramagnetic resonance (EPR) with unnatural amino acids: Site-specific probing of structure

    • Vibrational spectroscopy: Bond-specific information during transport

    • Time-resolved X-ray solution scattering (TR-XSS): Capturing transient conformational states

    • Neutron scattering: Distinguishing protein from lipid components without labeling

    • Native mass spectrometry: Analyzing intact membrane protein complexes

  • Computational advances:

    • AI-based structure prediction (AlphaFold, RoseTTAFold): Accurate models from sequence alone

    • Enhanced sampling methods: Accessing longer timescales in simulations

    • Quantum computing applications: Solving complex conformational ensembles

    • Multiscale modeling: Connecting molecular events to cellular phenotypes

    • Explainable AI for mechanism identification: Extracting mechanistic insights from complex datasets

  • Emerging reconstitution technologies:

    • Droplet interface bilayers: High-throughput functional assessment

    • DNA-origami scaffolded nanodiscs: Precise control of membrane environment

    • 3D-printed artificial cells: Reconstitution in cell-like compartments

    • Microfluidic platforms: Single-vesicle transport assays

    • Biomimetic membranes with native-like complexity: Incorporating multiple lipid types and membrane proteins

These emerging technologies are expanding the experimental toolkit available for studying challenging membrane proteins like yhhJ, potentially revealing aspects of structure, dynamics, and function that have been inaccessible with conventional approaches .

How can inconsistencies in experimental data about yhhJ be effectively analyzed and resolved?

Analyzing and resolving inconsistencies in experimental data for membrane transporters like yhhJ requires systematic approaches to distinguish technical artifacts from biologically meaningful variations:

  • Sources of inconsistencies in membrane protein research:

    • Detergent effects on protein conformation and activity

    • Lipid composition influences on transporter function

    • Expression system variations affecting post-translational modifications

    • Purification method effects on protein stability

    • Experimental condition differences (temperature, pH, ionic strength)

    • Presence of contaminants or co-purifying proteins

  • Systematic analysis framework:

    Analysis StepMethodologyOutcome
    Data formalizationStructured representation of experimental findingsEnables automated contradiction detection
    Contradiction detectionKnowledge graph analysis with logical inference rulesIdentification of directly conflicting statements
    Anti-pattern identificationExtraction of minimal contradicting statement setsClassification of inconsistency types
    Statistical assessmentQuantification of contradiction prevalencePrioritization of issues for resolution
  • Knowledge graph approach for inconsistency analysis:

    • Represent experimental findings as structured statements (subject-predicate-object)

    • Apply logical inference rules to detect contradictions

    • Identify minimal sets of contradicting statements (anti-patterns)

    • Quantify the prevalence of specific contradiction types

    • This approach can identify logical inconsistencies in large datasets that might not be apparent through manual inspection

  • Resolution strategies:

    • Meta-analysis approaches: Statistical integration of multiple studies

    • Controlled comparison experiments: Systematic variation of conditions

    • Independent method validation: Verification using orthogonal techniques

    • Root cause analysis: Identification of specific variables driving inconsistencies

    • Bayesian framework: Incorporation of uncertainty in data interpretation

  • Implementation steps for inconsistency resolution:

    • Create standardized experimental protocols to minimize methodological variations

    • Implement comprehensive reporting of experimental conditions

    • Establish benchmark datasets for method validation

    • Develop collaborative platforms for data sharing and comparison

    • Implement automated quality control metrics for data assessment

  • Case study approach:

    • When inconsistencies are identified in yhhJ literature, researchers can:

    • Categorize contradictions by type (functional, structural, regulatory)

    • Assess methodological differences between conflicting studies

    • Design targeted experiments to directly address specific contradictions

    • Integrate findings into updated models accommodating contextual differences

By applying these systematic approaches, researchers can transform apparent inconsistencies from obstacles into opportunities for deeper understanding of context-dependent behavior of membrane transporters like yhhJ .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.