Recombinant Innexin-10 (inx-10)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
inx-10; opu-10; T18H9.5; Innexin-10; Protein opu-10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-559
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
inx-10
Target Protein Sequence
MVLAAVLSMLRYVGGSDDRDFVDRLHSYFTCNLLIGLAVLVSFKQFGGKPVECLVPDIFS SSWEQYAENYCWASDTYYVPTNEPVAGLQSDEKRQRKISYYQWVPFFLLLEAACFRLPSL LWKYLAGHSGIKINEIVKLSSDPNNIKPDIKRANIKSLTVHLQGALRFHRRLQKKQIRPH RFLWLFNLPYSAFFVTAMYLCTKFFYLANVCLQLMFMNRFLETDKYKWYGMGALVDLLNG TTWEQSGMFPRVSLCDFDVRVMGNMQEHTIQCVLVINIFNEKIFILLWFWYLALLVFTFG SFFYWLLVSLWRHLNVRFIIRHLEMSDIAFDSSEDGAQEKVNRFISNYLKSDGVFVIRMM TLQSGVIFGTDLVQELWRNFHGSEPQLKRSNSAPKIEEREQWWPAYPSLVNPINPWRYRD ENQANALRWRRALGANVDNSIATQDLMEKLLPQNAHMRPSDDELLNRQPIAVQASYIDDE SDGKLKNEEKQNQQNATQPPYCYTNQNPTPYQNQNQIQNQNQYSNYYRTPSLSRGTDSRP VSTATDTDQTKKQSMSTFK
Uniprot No.

Target Background

Function
A structural component of gap junctions.
Database Links

KEGG: cel:CELE_T18H9.5

STRING: 6239.T18H9.5a

UniGene: Cel.3202

Protein Families
Pannexin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is Innexin-10 and what is its role in C. elegans?

Innexin-10 (INX-10) is one of the 25 members of the innexin family of gap junction proteins found in C. elegans. It functions as a critical component in the formation of electrical synapses or gap junctions between body-wall muscle cells. INX-10 contributes to electrical coupling by allowing the passage of ions and small molecules between adjacent cells, thus facilitating intercellular communication. Studies have shown that INX-10 works in conjunction with other innexins, particularly INX-1, INX-11, and INX-16, to form one distinct population of gap junctions in body-wall muscle cells .

How many isoforms of INX-10 have been identified?

Three distinct isoforms of INX-10 have been identified through cDNA cloning techniques. These include the previously known isoform T18H9.5a and two novel isoforms that have been registered in GenBank under the accession numbers KF137643 and KF137644 . These isoforms were identified through RT-PCR using primer pairs complementary to the 5'- and 3'-ends of the coding sequences, with the T18H9.5a isoform serving as the reference for primer design. The presence of multiple isoforms suggests potential functional diversity or tissue-specific expression patterns of INX-10 .

Where is INX-10 expressed in C. elegans?

INX-10 demonstrates a specific expression pattern in C. elegans that has been visualized using promoter::GFP transcriptional fusion approaches. While detailed cell-specific expression data for INX-10 isn't explicitly provided in the search results, a high-resolution expression map of all 25 innexin family members in C. elegans has been created . This map reveals the unexpected dynamism, range, and complexity of innexin expression patterns in general. For many innexins, including INX-10, expression has been analyzed using an in vivo homologous recombination approach, allowing inclusion of entire promoter regions in most cases .

How does INX-10 interact with other innexins to form functional gap junctions?

INX-10 forms functional gap junctions by working in concert with other specific innexins. Electrophysiological analyses using single and double mutants have revealed that INX-10 functions together with INX-1, INX-11, and INX-16 to form one distinct population of gap junctions in body-wall muscle cells, while UNC-9 and INX-18 form a separate population .

This functional relationship was demonstrated through junctional conductance (Gj) measurements in various innexin mutants. When comparing Gj between inx-1(lf);inx-10(lf) double mutant and either inx-1(lf) or inx-10(lf) single mutants, no significant difference was observed, suggesting these two innexins function together. Similarly, when analyzing the inx-10(lf);inx-11(lf) double mutant, Gj was not further decreased compared to inx-11(lf) and inx-16(lf) single or double mutants, indicating that all four innexins (INX-1, INX-10, INX-11, and INX-16) likely contribute to a single population of gap junctions .

What is the molecular structure of INX-10 and how does it compare to other innexins?

While the detailed molecular structure of INX-10 is not explicitly described in the provided search results, innexins generally share a common topology with four transmembrane domains, two extracellular loops, and cytoplasmic N- and C-terminal domains. The cDNA cloning of INX-10 has identified three distinct isoforms (T18H9.5a and two novel ones: GenBank KF137643 and KF137644), suggesting potential structural variations that might influence function .

Comparative analysis between INX-10 and other innexins can be inferred from functional studies. For instance, INX-10 appears to be functionally more similar to INX-1 than to INX-11 or INX-16, as evidenced by similar junctional conductance deficiencies in their respective mutants. The conductance deficiency was less pronounced in inx-1(lf) and inx-10(lf) mutants compared to inx-11(lf) and inx-16(lf) mutants, indicating potential structural or functional differences between these pairs of innexins .

How do mutations in INX-10 affect gap junction function and organism phenotype?

Mutations in INX-10 lead to measurable deficiencies in gap junction function, specifically in electrical coupling between body-wall muscle cells. Electrophysiological studies have quantified this deficiency through measurements of junctional current (Ij) and conductance (Gj). INX-10 loss-of-function (lf) mutants show reduced junctional conductance compared to wild-type, though the deficiency is less severe than that observed in mutants of some other innexins such as UNC-9 .

What techniques are used for cloning and expressing recombinant INX-10?

Cloning of INX-10 cDNA has been accomplished through RT-PCR using primer pairs complementary to the 5'- and 3'-ends of the coding sequence, with the T18H9.5a isoform as reference. The specific approach involved the following steps as described in the literature:

  • Primer design based on reported cDNA sequences from the Wormbase database

  • RT-PCR amplification of the INX-10 coding sequence

  • Identification of multiple isoforms, including the previously known T18H9.5a and two novel isoforms (GenBank KF137643 and KF137644)

For expression studies, the homologous recombination approach has been used to generate promoter::GFP transcriptional fusions, allowing visualization of expression patterns. This approach enables inclusion of the entire promoter region, providing a more accurate representation of the natural expression pattern than traditional transgenic methods .

How can INX-10 expression patterns be visualized in vivo?

Visualization of INX-10 expression patterns in vivo can be achieved using several complementary approaches:

  • Promoter::GFP Transcriptional Fusions: This approach involves creating a construct where the INX-10 promoter drives expression of GFP. These constructs are injected into C. elegans, typically using a co-transformation marker such as lin-15 rescue plasmid. GFP fluorescence can then be visualized using fluorescence microscopy with appropriate filters (e.g., FITC filter) .

  • Translational GFP Fusions: By fusing GFP to the INX-10 protein itself, researchers can observe the subcellular localization of the protein in addition to its expression pattern. This approach has revealed punctate localization of many innexins at muscle intercellular junctions .

  • Antibody Staining: Though not specifically mentioned for INX-10 in the search results, immunohistochemistry using antibodies against innexins has been used to study fixed animals and can provide high-resolution data on protein localization .

How are electrophysiological measurements of INX-10-mediated coupling conducted?

Electrophysiological measurements of gap junction-mediated electrical coupling involve quantification of junctional current (Ij) and conductance (Gj). While the specific methodology isn't detailed in the search results, typical approaches include:

  • Dual Whole-Cell Patch Clamp: This technique involves establishing whole-cell patch clamp recordings from two adjacent muscle cells and measuring the current that flows from one cell to another in response to voltage changes.

  • Junctional Conductance Calculation: Gj is calculated from the junctional current measurements and provides a quantitative measure of gap junction function.

These measurements have been applied to various innexin mutants, including inx-10(lf), to assess the contribution of each innexin to electrical coupling. Comparisons between single, double, and triple mutants have provided insights into the functional relationships between different innexins, including INX-10 .

What evidence suggests INX-10 forms heteromeric gap junctions with other innexins?

  • Similar Gj in Single and Double Mutants: The junctional conductance in inx-1(lf);inx-10(lf) double mutant was indistinguishable from that in either inx-1(lf) or inx-10(lf) single mutant, suggesting these proteins function together rather than independently .

  • No Further Reduction in Triple Mutants: The inx-10(lf);inx-11(lf) double mutant did not show further decreased conductance compared to inx-11(lf) and inx-16(lf) single or double mutants, suggesting all four innexins (INX-1, INX-10, INX-11, and INX-16) contribute to a single population of gap junctions .

  • Distinct Populations of Gap Junctions: When mutations in innexins from different proposed populations were combined (e.g., unc-9 with inx-10 or inx-11), the resulting decrease in Gj was greater than in single mutants, suggesting these innexins form separate gap junction populations .

How does INX-10 contribution to electrical coupling compare with other innexins?

The comparative contribution of INX-10 and other innexins to electrical coupling can be quantified through junctional conductance measurements in respective mutants. Based on the available data, the following comparisons can be made:

Innexin MutantRelative Reduction in GjFunctional Grouping
inx-10(lf)ModerateGroup with INX-1, INX-11, INX-16
inx-1(lf)ModerateGroup with INX-10, INX-11, INX-16
inx-11(lf)SignificantGroup with INX-1, INX-10, INX-16
inx-16(lf)SignificantGroup with INX-1, INX-10, INX-11
unc-9(lf)Most severeGroup with INX-18
inx-18(lf)ModerateGroup with UNC-9

Key observations from this comparison:

  • INX-10 and INX-1 show similar moderate reductions in Gj when mutated

  • INX-11 and INX-16 mutants exhibit more significant coupling deficiencies

  • UNC-9 appears to make the largest individual contribution to electrical coupling

  • The combined Gj deficiency in all six innexin mutants exceeds 100%, suggesting complex interactions between the two proposed gap junction populations

What rescue experiments confirm the cell-autonomous function of INX-10?

Rescue experiments provide compelling evidence for the cell-autonomous function of INX-10 in body-wall muscle cells. The junctional current (Ij) deficiency in inx-10 mutants was completely rescued by expressing the corresponding wild-type innexin specifically in muscle cells . This demonstrates that INX-10 functions directly in the muscle cells rather than influencing gap junction formation indirectly through effects on other cell types.

How conserved is INX-10 across nematode species?

While the search results don't provide explicit information about the evolutionary conservation of INX-10 across nematode species, there is indirect evidence suggesting some degree of conservation. The cloning of novel cDNA isoforms for several innexins, including INX-10, was aided by comparing genomic DNA sequences between C. elegans and C. briggsae . This approach successfully identified novel exons, indicating sequence conservation between these nematode species.

The innexin gene family as a whole shows evolutionary significance, with 25 members in C. elegans . This large family size suggests functional diversification and specialization of innexins throughout nematode evolution. For a more comprehensive understanding of INX-10 conservation, comparative genomic analyses across more nematode species would be needed.

How does the function of INX-10 compare to connexins in vertebrates?

The complex interactions observed between INX-10 and other innexins in forming heteromeric gap junctions parallels the behavior of connexins in vertebrates, which also form heteromeric and heterotypic channels with distinct functional properties. The finding that six different innexins contribute to electrical coupling in C. elegans body-wall muscle cells demonstrates a level of complexity in gap junction composition that is also observed in vertebrate tissues .

What are the main technical challenges in producing recombinant INX-10?

Although the search results don't specifically address technical challenges in producing recombinant INX-10, several common challenges can be inferred based on general innexin research:

  • Multiple Isoforms: The presence of three distinct isoforms of INX-10 (T18H9.5a and two novel isoforms) presents challenges in deciding which isoform to express and characterizing potential functional differences.

  • Membrane Protein Expression: As a transmembrane protein that forms complex multimeric structures, INX-10 may present challenges for heterologous expression and purification while maintaining proper folding and function.

  • Complex Interactions: The functional interaction of INX-10 with at least three other innexins (INX-1, INX-11, and INX-16) suggests that studying the protein in isolation may not fully recapitulate its native function.

How can researchers overcome limitations in studying INX-10 interactions with other innexins?

Researchers can employ several strategies to overcome challenges in studying INX-10 interactions with other innexins:

  • Combinatorial Genetic Approaches: Creating and analyzing various combinations of innexin mutants, as demonstrated in the electrophysiological studies , can reveal functional interactions between INX-10 and other innexins.

  • Co-expression Systems: Developing systems where multiple innexins can be co-expressed in heterologous cells or in vivo can help study their combined effects on gap junction formation and function.

  • High-Resolution Imaging: Advanced microscopy techniques to visualize the co-localization of differentially tagged innexins can provide spatial information about their interactions.

  • Electrophysiological Measurements: Quantitative assessment of junctional conductance in various genetic backgrounds provides functional evidence of interactions between INX-10 and other innexins.

  • Biochemical Interaction Studies: Though technically challenging with membrane proteins, techniques such as co-immunoprecipitation or proximity labeling could potentially identify direct interactions between INX-10 and other proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.