Recombinant Innexin-11 (inx-11)

Shipped with Ice Packs
In Stock

Description

Gastrointestinal System

  • Rhythmic Defecation: INX-11 is expressed in posterior intestinal cells, acting as a pacemaker for defecation cycles .

  • Intestinal Muscle Contractions: Collaborates with INX-16 to propagate Ca²⁺ waves between intestinal cells, essential for peristalsis .

Muscle Electrical Coupling

INX-11 contributes to electrical coupling in body-wall muscles, working synergistically with INX-1, INX-10, INX-16, and UNC-9. Key findings:

  • Junctional Conductance: Mutants of inx-11 show reduced electrical coupling, rescued by muscle-specific expression of wild-type INX-11 .

  • Functional Pairing: Forms a cooperative unit with INX-16, distinct from the UNC-9/INX-18 complex .

Localization

  • Punctate distribution at muscle intercellular junctions and dense bodies, confirmed via GFP-tagged constructs .

Production Workflow

  • Cloning: cDNA isoforms (e.g., W04D2.3b) are cloned via RT-PCR and expressed under the myo-3 promoter for muscle-specific studies .

  • Functional Validation: Rescue experiments in inx-11(lf) mutants confirm activity of recombinant INX-11::GFP fusion proteins .

Research Applications

  • Gap Junction Dynamics: Used to study channel assembly, conductivity, and regulation in C. elegans tissues .

  • Disease Modeling: Insights into pathologies linked to gap junction dysfunction, such as motility disorders or intestinal dysmotility .

Comparative Analysis of Innexin Contributions

FunctionKey InnexinsDeficiency Phenotype
Intestinal CouplingINX-11, INX-16Constipation, reduced brood size
Muscle Electrical CouplingINX-11, INX-16, INX-1, INX-10, UNC-9, INX-18Reduced locomotion, uncoordinated movement

Challenges and Future Directions

  • Structural Resolution: The lack of high-resolution 3D structures limits mechanistic insights into INX-11 channel gating.

  • Cross-Species Homology: Functional conservation with mammalian connexins remains underexplored .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
inx-11; opu-11; W04D2.3; Innexin-11; Protein opu-11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-465
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
inx-11
Target Protein Sequence
MVMIETFLGMAKYLSPREDDDWSDRLNYLMTPNILLAFSVLISFKQFGGRPIECMFPNKF PGSWEQYAENYCWSQDTYFVEPTQDVSLLKKEERYTPDRQLSYYQWVPFFLLLQAAFFRA PSYLWKYFSNHSGIRIHEVVEKAKDSANVEEEVREKNILILKRHLSSALRFQANMERKKV QVHKTVTFLNFQYSSGFISWIYLFTKVLYFLNVFAQLYLMNYFLGTNRHHWYGFGVVQDI VQGEPWERSGYFPRAAVCDFEVRQVANIQRYSVQCVLVINIFNEKIFVLLWFWYVILLLS STVSLVQWFIVLVFPCFSKWFVKQHLALSTLQNFNQRNSRREDSDVSKFVTQYLHKDGVF VLRMVSSHAGIIFATDLVQALYEAYDFQDKNKDVQGSPVSDDLQTISTGAESSIRQRKTR KGSRIEYKAGFPISTSLMPDKDDIESSSTSSEEDQKRVSNVITNI
Uniprot No.

Target Background

Function
Innexin-11 (inx-11) is a structural component of gap junctions.
Database Links

STRING: 6239.W04D2.3b

UniGene: Cel.3201

Protein Families
Pannexin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is Innexin-11 and what is its functional role in C. elegans?

Innexin-11 (INX-11) is a gap junction protein that contributes significantly to electrical coupling between body-wall muscle cells in C. elegans. It functions as one of six innexins (along with UNC-9, INX-1, INX-10, INX-16, and INX-18) that mediate junctional current (Ij) in these muscle cells . When INX-11 is mutated, there is a substantial reduction in junctional conductance (Gj), indicating its importance in establishing functional electrical synapses . Research has shown that INX-11 functions cell-autonomously in muscle cells, as the coupling deficiency in inx-11 mutants can be completely rescued by expressing wild-type INX-11 specifically in muscle tissue .

What is known about the subcellular localization of Innexin-11?

When expressed as a Myc-tagged fusion protein (Myc::INX-11), INX-11 displays a distinctive punctate localization pattern at muscle intercellular junctions and inside muscle cells, likely corresponding to dense bodies . The size and density of these puncta appear to be distinct from those formed by other innexins, suggesting a unique spatial organization . This localization pattern provides critical insights into how INX-11 may contribute to the formation of gap junctions specifically at muscle cell interfaces.

What expression systems are most effective for producing recombinant Innexin-11?

Based on successful approaches with other innexins, the baculovirus expression system using Sf9 insect cells is recommended for recombinant INX-11 production. The methodology would involve:

  • Cloning the full-length C. elegans inx-11 gene into a baculovirus transfer vector such as pFastBac1

  • Adding appropriate tags (His-tag or GFP-His-tag) at the C-terminus for purification

  • Generating recombinant baculoviruses using the bacmid system

  • Infecting Sf9 cells with the recombinant virus at 27°C

  • Harvesting cells approximately 30 hours post-infection

This approach has been successfully used for INX-6, providing a viable template for expressing other innexin family members including INX-11 .

What purification strategy should be employed for recombinant Innexin-11?

For purification of recombinant INX-11, a multi-step approach based on membrane isolation followed by affinity chromatography is recommended:

  • Cell membrane isolation:

    • Suspend infected cells in buffer containing 10 mM Tris (pH 7.5), 150 mM NaCl, and 1 mM phenylmethylsulfonyl fluoride

    • Disrupt cells by sonication (approximately 90 seconds)

    • Collect membranes by centrifugation at 22,100 × g for 25 minutes

  • Protein solubilization and purification:

    • Resuspend membranes in buffer containing 10 mM Tris (pH 7.5), 150 mM NaCl, and 1% dodecyl maltoside (DDM)

    • Solubilize for 30 minutes at 4°C

    • Remove debris by centrifugation

    • Purify using nickel-nitrilotriacetic acid agarose

    • Wash with 10 mM L-histidine and elute with 300 mM L-histidine

This method avoids harsh alkali extraction conditions that might damage the innexin protein structure, which is particularly important for preserving the functionality of the purified channels .

How can the oligomeric state of purified Innexin-11 be determined?

The oligomeric state of purified INX-11 can be assessed using multiple complementary approaches:

  • Gel filtration chromatography:

    • Analyze the elution profile of purified INX-11 in different detergents

    • Compare elution volumes with known protein standards

    • Different detergents can yield different oligomeric states (hemichannels vs. complete channels)

  • Native PAGE analysis:

    • Compare migration patterns in different detergents

    • Identify shifts in molecular weight indicating oligomerization

  • Electron microscopy:

    • Negative staining of purified protein

    • Single particle analysis to obtain class averages

    • Structural characterization of channel dimensions

DetergentExpected Oligomeric StateApproximate Molecular Weight
DDMHemichannels~400 kDa
OGNGComplete channels~800 kDa

These values are based on data from INX-6 and would need to be experimentally verified for INX-11 .

How do mutations in Innexin-11 affect electrical coupling in C. elegans muscle?

Mutations in the inx-11 gene cause significant defects in electrical coupling between body-wall muscle cells. Quantitative analysis of junctional conductance (Gj) reveals that inx-11(lf) mutants show substantial reduction in coupling compared to wild-type animals . The coupling deficiency in inx-11 mutants appears to be more severe than that observed in inx-1 or inx-10 mutants but comparable to that seen in inx-16 mutants . This suggests that INX-11 plays a more crucial role in establishing functional gap junctions than some other innexin family members.

When inx-11 mutations are combined with mutations in other innexins like unc-9, the coupling defects become even more pronounced, with junctional current (Ij) becoming virtually indistinguishable from baseline noise . This indicates synergistic effects between different innexin populations in maintaining electrical coupling.

What techniques are most effective for studying Innexin-11 function in vivo?

Several complementary approaches can be employed to study INX-11 function in vivo:

  • Electrophysiological recordings:

    • Measure junctional current (Ij) and conductance (Gj) between coupled muscle cells

    • Compare wild-type, single mutants, and double/triple mutants

    • Quantify changes after rescue experiments

  • Fluorescent protein tagging:

    • Create INX-11::GFP or Myc::INX-11 fusion constructs

    • Express under tissue-specific promoters (e.g., Pmyo-3 for muscle expression)

    • Visualize subcellular localization and junction formation

  • Rescue experiments:

    • Express wild-type INX-11 in inx-11 mutant backgrounds

    • Use tissue-specific promoters to determine cell autonomy

    • Quantify functional recovery using electrophysiological measurements

  • Dye transfer assays:

    • Inject fluorescent tracers of different molecular weights

    • Measure intercellular diffusion rates

    • Compare permeability properties between different innexin channels

What is the relationship between Innexin-11 and other innexins in forming functional gap junctions?

INX-11 appears to function as part of a distinct population of gap junctions that includes INX-16, INX-1, and INX-10. Analysis of single and double mutant combinations reveals several key relationships:

  • INX-11 and INX-16 likely function together:

    • The inx-11(lf); inx-16(lf) double mutant shows similar conductance defects to either single mutant

    • This suggests they contribute to the same population of gap junctions

  • INX-1 and INX-10 also function together but with distinct properties:

    • Single or double mutants of inx-1 and inx-10 show less severe coupling defects than inx-11 and inx-16 mutants

    • The inx-10(lf); inx-11(lf) double mutant does not show further decreased conductance compared to inx-11 mutants alone

  • Two separate populations of gap junctions exist in body-wall muscle:

    • One population consists of UNC-9 and INX-18

    • The other consists of INX-1, INX-10, INX-11, and INX-16

Innexin CombinationsJunctional Conductance (Gj)Likely Functional Relationship
INX-11 + INX-16Significantly reducedFunction together
INX-1 + INX-10Moderately reducedFunction together
INX-11/16 + INX-1/10No further reductionPart of same gap junction population
INX-11/16 + UNC-9Severely reducedSeparate gap junction populations

How can recombinant Innexin-11 channels be functionally characterized in heterologous expression systems?

Functional characterization of recombinant INX-11 channels in heterologous systems can be achieved through:

  • Electrophysiological analysis:

    • Whole-cell patch-clamp recordings to measure macroscopic currents

    • Single-channel recordings to determine unitary conductance

    • Voltage-step protocols to assess voltage-dependent gating properties

  • Dye transfer assays:

    • Microinjection of fluorescent tracers (3-10 kDa) into expressing cells

    • Monitoring intercellular diffusion rates using time-lapse fluorescence microscopy

    • Comparing permeability with other gap junction proteins

  • Hemichannel activity assays:

    • Dye uptake experiments in low calcium conditions

    • ATP release measurements

    • Cell volume regulation studies

  • Calcium imaging:

    • Monitor calcium wave propagation between coupled cells

    • Assess the role of INX-11 channels in calcium signaling

These approaches would need to be adapted specifically for INX-11, drawing on successful strategies used with other innexin family members like INX-6 .

What structural analysis methods are most suitable for investigating Innexin-11 channel architecture?

Several complementary structural biology techniques can be employed to investigate INX-11 channel architecture:

  • Electron microscopy:

    • Negative staining of purified channels for initial characterization

    • Single particle analysis to generate class averages

    • Cryo-EM for higher resolution structural information

  • X-ray crystallography:

    • Requires highly purified, stable, and homogeneous protein preparations

    • May require modification of flexible regions or use of antibody fragments to facilitate crystallization

  • Atomic force microscopy (AFM):

    • Analysis of channel topology in lipid bilayers

    • Measurement of channel dimensions and packing in 2D arrays

  • Crosslinking mass spectrometry:

    • Identification of interacting domains between adjacent subunits

    • Mapping the topology of the assembled channel

Based on successful approaches with INX-6, channel dimensions that might be expected for INX-11 include a longitudinal height of approximately 220 Å, a channel diameter of 110-140 Å, and an extracellular gap space of around 60 Å .

What strategies can address challenges in expressing and purifying functional Innexin-11?

Researchers may encounter several challenges when working with recombinant INX-11. The following strategies can help address these issues:

  • Low expression levels:

    • Optimize codon usage for the expression system

    • Test different promoters and expression conditions

    • Consider fusion partners that enhance expression

    • Explore alternative cell lines or expression systems

  • Protein misfolding and aggregation:

    • Test multiple detergents for solubilization (DDM, OGNG, digitonin)

    • Include stabilizing agents during purification

    • Optimize buffer conditions (pH, salt concentration, additives)

    • Consider membrane scaffold proteins for nanodiscs

  • Limited stability of purified protein:

    • Identify optimal storage conditions

    • Add lipids during purification to maintain native environment

    • Use smaller tags or implement tag removal after purification

    • Explore protein engineering to improve stability

  • Difficulty assessing functionality:

    • Develop robust assays for channel activity

    • Implement reconstitution into liposomes or planar lipid bilayers

    • Use fluorescence-based assays for high-throughput screening

How does Innexin-11 differ structurally and functionally from vertebrate gap junction proteins?

Innexins and vertebrate connexins share functional similarities as gap junction proteins but differ significantly in sequence and structure:

What are the most promising directions for future research on Innexin-11?

Several promising research directions could advance our understanding of INX-11:

  • High-resolution structural studies:

    • Determination of atomic or near-atomic resolution structures of INX-11 channels

    • Comparative analysis with other innexin family members

    • Investigation of structural basis for selectivity and gating

  • Regulatory mechanisms:

    • Identification of post-translational modifications affecting INX-11 function

    • Characterization of proteins interacting with INX-11

    • Elucidation of trafficking and degradation pathways

  • Physiological roles:

    • Development of tissue-specific and conditional knockout models

    • Investigation of INX-11's role in development and aging

    • Exploration of potential roles in neuronal function beyond muscle

  • Therapeutic applications:

    • Evaluation of INX-11 as a potential drug target

    • Development of peptides or small molecules that modulate INX-11 function

    • Investigation of potential roles in disease models

How can computational approaches enhance our understanding of Innexin-11?

Computational methods offer powerful tools for investigating aspects of INX-11 structure and function that may be challenging to address experimentally:

  • Homology modeling:

    • Generate structural models based on related proteins with known structures

    • Predict the topology and organization of transmembrane domains

    • Model the quaternary structure of assembled channels

  • Molecular dynamics simulations:

    • Investigate channel gating mechanisms

    • Study ion and metabolite permeation

    • Examine protein-lipid interactions

  • Systems biology approaches:

    • Model electrical coupling in neural and muscle networks

    • Predict the effects of mutations on network function

    • Integrate multi-scale data from molecular to cellular levels

  • Machine learning applications:

    • Predict functional properties from sequence information

    • Identify potential protein-protein interaction partners

    • Discover small molecules that might modulate channel function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.