Recombinant Innexin-14 (inx-14)

Shipped with Ice Packs
In Stock

Description

Germline-Intestinal Defense Coordination

INX-14 in the germline suppresses intestinal defense against Pseudomonas aeruginosa PA14 by:

  • Attenuating PMK-1/p38 MAPK signaling .

  • Downregulating lysosome pathway activity .

  • Modulating GLP-1/Notch signaling to regulate gut immunity .

Reproductive Tract Signaling

INX-14 in oocyte precursors regulates:

  • Sperm migration velocity and directional guidance via prostaglandin signaling .

  • Prostaglandin metabolism, with mutants showing elevated F-series prostaglandins (e.g., CePGF2) .

GLP-1/Notch Signaling Axis

  • Germline-specific inx-14 knockdown reduces glp-1 and lin-12 (Notch receptors) expression, activating PMK-1/p38-dependent immune responses .

  • INX-14 loss upregulates lysosome-related genes (e.g., laat-1, hlh-30), enhancing bacterial clearance .

Prostaglandin Regulation

  • INX-14 inhibits DAF-16/FOXO activity in oocyte precursors, reducing prostaglandin synthesis .

  • inx-14(ag17) mutants exhibit 2.5-fold higher CePGF2 levels compared to wild-type .

Infection Resistance

Parameterinx-14(ag17) Mutants vs. Wild-Type
PA14 survival rateIncreased by 40%
Intestinal PA14 accumulationReduced by 60% (GFP-labeled assay)
PMK-1/p38 activationUpregulated (e.g., K08D8.5p::GFP intensity +300%)

Prostaglandin Levels

Prostaglandininx-14(ag17) vs. Wild-Type (Fold Change)
CePGF2 (m/z 353/193)2.5× increase
PGF3 analogs (m/z 351/191)1.8× increase

Applications of Recombinant INX-14

While recombinant INX-14 has not been explicitly studied, its native form’s roles suggest potential applications:

  • Drug Discovery: Targeting INX-14-mediated pathways could modulate host-pathogen interactions or inflammatory responses.

  • Reproductive Health: Studying INX-14’s role in prostaglandin signaling may inform fertility research.

  • Aging Studies: Links between DAF-16/FOXO and INX-14 could elucidate longevity mechanisms.

Future Directions

  • Structural studies of recombinant INX-14 channels.

  • High-throughput screening for INX-14 inhibitors/activators.

  • Cross-species comparisons to assess evolutionary conservation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
inx-14; opu-14; F07A5.1; Innexin-14; Protein opu-14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-434
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
inx-14
Target Protein Sequence
MIWEIPIIGDFITKPFKAAKLYEFYDRLHLFTVYLLGFFVLLTGAKQHFGNPIDCMLPKQ HDDLKSWRDYIHNFCLFYGTFRYDVSNGTSEFGSYTEDASVNYYQWVPFFFAFQVCCFLL PFWCWAYMQKLIYIDMAFIVDYSGKINSEKTFEKTKEKVDRIVNYMHDHFKFRRAHKMGY LSWITFNSAFPSVLYSLTKLFFITNVIIQVNLVCKFLDVDSWTWGFDLLGKFIHPTPRAP EFSSFSDKQRFAAILTDGSYNRFQYFPILVGCEYQLQESVSNFVNHKAQCIIPMNVINEK IFIGLYFWLLVLTALSVIGTVKWILRIKSKKLNEVMIYKLIKKSLEREPFDSNIHDHRYN FVHKYLCADGILLIYFMMDTNGFLKTEEVIGALFKKYCSDAGLEPLQTAPTLTSSPRDLA YSETNYGFAAPQKI
Uniprot No.

Target Background

Function
Recombinant Innexin-14 (inx-14) is a structural component of gap junctions.
Gene References Into Functions
  1. Research indicates that INX-14 plays a role in a somatic gonad/germ cell signaling pathway crucial for sperm function. PMID: 21889935
Database Links

KEGG: cel:CELE_F07A5.1

STRING: 6239.F07A5.1b

UniGene: Cel.22679

Protein Families
Pannexin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is Innexin-14 and what is its primary biological function?

Innexin-14 (INX-14) is a subunit of invertebrate gap junctions that plays crucial roles in cellular communication. In C. elegans, INX-14 has been extensively characterized for its function in reproductive biology. Research demonstrates that INX-14 promotes sperm guidance to the fertilization site in the C. elegans hermaphrodite reproductive tract. Loss of INX-14 function causes cell non-autonomous defects in sperm migration velocity and directional velocity, indicating its importance in reproductive processes. INX-14 has been shown to function in the germ line, regulating multiple processes including germ cell proliferation, differentiation, oocyte maturation, and sperm distribution within the uterus .

Beyond reproduction, INX-14 is involved in regulating transcriptional mechanisms, particularly through interaction with DAF-16/FOXO transcription factors. The protein appears to have both channel-dependent functions (forming gap junctions) and potentially channel-independent functions in signal transduction. Researchers studying INX-14 should understand its multifaceted roles in cellular signaling, intercellular communication, and reproductive biology .

How does INX-14 expression and localization change during oocyte development?

INX-14 demonstrates distinct localization patterns that change during gonad development. Immunocytochemical analyses reveal that INX-14 forms punctate structures at the interface between germline cells and somatic gonadal sheath cells. The protein shows differential expression and localization between the distal and proximal regions of the gonad .

This differential localization is functionally significant, as evidence suggests INX-14 acts in transcriptionally active oocyte precursors in the distal gonad rather than in transcriptionally inactive mature oocytes. Researchers should note that this localization pattern provides important clues about the protein's function in reproductive processes .

What experimental systems are most suitable for studying INX-14 function?

C. elegans represents the optimal model system for studying INX-14 function due to its genetic tractability, transparent body allowing for live imaging, and well-characterized reproductive system. Several experimental approaches have proven effective for INX-14 research:

  • Genetic approaches: Utilizing hypomorphic mutants like inx-14(ag17) allows researchers to bypass the developmental requirement of INX-14 while still studying its function in adult processes. This mutant contains a missense mutation resulting in an arginine to histidine substitution near the third transmembrane domain .

  • RNA interference: Stage-specific RNAi initiated during L4 and adult stages can overcome the early developmental requirements for INX-14, enabling the study of its role in reproduction without confounding developmental phenotypes .

  • Temperature-sensitive conditioning: Growing inx-14(ag17) mutants at 20°C until L4 or young adult stages and then shifting to 25°C for 24-36 hours provides a controlled system for studying INX-14 function in reproductive processes .

  • Sperm tracking assays: Using MitoTracker-labeled male sperm to mate with inx-14 mutant or RNAi-treated hermaphrodites allows for quantitative assessment of sperm guidance defects, including measurements of sperm migration velocity, directional velocity, and reversal frequency .

These methodologies provide complementary approaches to investigate different aspects of INX-14 function in cellular communication and reproductive biology .

How does INX-14 interact with the prostaglandin signaling pathway to regulate sperm guidance?

INX-14 plays a critical role in prostaglandin signaling to regulate sperm guidance, functioning upstream of prostaglandin production. The sperm migration behavior in inx-14(RNAi) hermaphrodites is nearly identical to that observed in prostaglandin-deficient strains, with reduced velocity, no directional velocity, and high reversal frequency. This suggests INX-14 promotes prostaglandin signaling to sperm .

Genetic interaction studies provide further evidence for this relationship. The RME-2 low-density lipoprotein receptor delivers prostaglandin PUFA precursors to oocytes in yolk lipoprotein complexes, and rme-2(b1008) mutants fail to synthesize prostaglandins. Double mutant analysis shows that inx-14(RNAi) does not enhance the sperm guidance defects of rme-2(b1008) mutants, consistent with both genes acting in the same genetic pathway .

Microinjection experiments demonstrate that human PGF2α into the uterus of inx-14(RNAi) hermaphrodites rescues the sperm velocity defects, confirming that INX-14 functions upstream of prostaglandin signaling. Interestingly, mass spectrometry analysis reveals that CePGF2 and other PGF2α analogs are actually increased in inx-14(ag17) mutant extracts relative to wild-type extracts. This suggests that INX-14 does not function at the level of prostaglandin synthesis but rather regulates prostaglandin metabolism, transport, or activity in the reproductive tract .

Researchers investigating the INX-14/prostaglandin relationship should employ a combination of genetic interaction studies, biochemical analyses of prostaglandin levels, and functional rescue experiments to delineate the precise mechanisms involved .

What is the relationship between INX-14, somatic gonadal sheath cells, and other innexins?

The function of INX-14 in sperm guidance requires interaction with somatic gonadal sheath cells, likely mediated through other innexins, particularly INX-8 and INX-9. Experimental evidence demonstrates that somatic gonadal sheath cell interaction is necessary for INX-14 function. When examining other innexins expressed in the gonad, strong sperm guidance defects were observed in inx-8(RNAi) and inx-9(RNAi) hermaphrodites .

To determine whether these innexins function in germ cells or sheath cells, researchers utilized rrf-1(pk1417) mutants, which lack RNA-dependent RNA polymerase required for RNAi in somatic sheath cells but not in germ cells. inx-8(RNAi) in the rrf-1(pk1417) background fails to cause sperm guidance defects, while inx-14(RNAi) still causes similar defects in both wild-type and rrf-1(pk1417) backgrounds. This differential response supports the model that INX-14 functions in the germ line while INX-8 and INX-9 function in sheath cells .

The precise mechanism of interaction between these innexins requires further investigation. Current evidence suggests two possibilities: (1) INX-14 mediates the assembly of gap junctions in the distal gonad that are difficult to document by electron microscopy, or (2) innexin-dependent contact between sheath cells and germ cells induces signal transduction independent of channel formation, possibly through conformational changes or adhesion-mediated signaling .

Researchers investigating these interactions should employ tissue-specific knockdown approaches, co-immunoprecipitation studies, and high-resolution imaging techniques to further elucidate the molecular mechanisms involved .

How do transcriptional mechanisms mediate INX-14 function in sperm guidance?

INX-14 functions in transcriptionally active oocyte precursors rather than transcriptionally inactive mature oocytes, suggesting that it regulates gene transcription essential for prostaglandin signaling. A key difference between oocyte precursors in the distal gonad and mature oocytes in the proximal gonad is that the former are transcriptionally active while the latter are not .

Evidence indicates that INX-14 signaling inhibits DAF-16/FOXO transcription factor activity. Loss of inx-14 (as well as inx-8 or inx-9) causes increased DAF-16/FOXO transcriptional activity, which has been shown to inhibit prostaglandin signaling and sperm guidance. This was demonstrated using transgenic strains expressing GFP under control of the sod-3 promoter, a direct downstream target of DAF-16 .

Researchers investigating the transcriptional mechanisms should employ RNA-sequencing to identify differentially expressed genes in inx-14 mutants, ChIP-seq to identify DAF-16 binding sites related to prostaglandin signaling, and genetic epistasis experiments with transcription factor mutants to dissect the signaling pathways involved .

What techniques are most effective for visualizing and quantifying INX-14 localization?

Several complementary techniques have proven effective for visualizing and quantifying INX-14 localization in C. elegans:

  • Immunocytochemistry: Using specific antibodies against INX-14 allows for detection of endogenous protein expression patterns. This approach revealed that INX-14 forms punctate structures at the interface between germline cells and somatic gonadal sheath cells. The technique permits quantification of puncta in different regions of the gonad .

  • Fluorescent protein tagging: Though not explicitly mentioned in the provided paper, fusion of INX-14 with fluorescent proteins like GFP can allow for live imaging of protein dynamics, though care must be taken to ensure the tag does not disrupt protein function.

  • Promoter analysis: Using reporter constructs with predicted promoters driving expression of fluorescent proteins helps determine the expression pattern of innexins in different tissues .

  • Quantitative image analysis: Researchers have developed methods to quantify the number and intensity of INX-14 puncta in different regions of the gonad, allowing for statistical comparison between wild-type and mutant animals .

For optimal results, researchers should dissect gonads from adult animals and process them for immunostaining according to established protocols. Special attention should be paid to fixation conditions to preserve the structure of gap junctions. Confocal microscopy with Z-stack acquisition is recommended for accurate visualization and quantification of punctate structures at cell interfaces .

How can researchers effectively assess sperm guidance defects in INX-14 mutants?

Assessment of sperm guidance defects in INX-14 mutants requires a combination of quantitative and qualitative approaches:

To implement these methods effectively, researchers should maintain consistent environmental conditions during imaging, use appropriate statistical analyses to compare multiple parameters between experimental groups, and include relevant controls such as wild-type matings and known prostaglandin-deficient mutants for comparison .

What biochemical approaches are useful for studying INX-14's role in prostaglandin signaling?

Several sophisticated biochemical approaches have been employed to elucidate INX-14's role in prostaglandin signaling:

  • Liquid chromatography electrospray ionization tandem mass spectrometry (LC-ESI-MS/MS): This technique, operated in multiple reaction monitoring (MRM) mode, allows for measurement of specific prostaglandin analogs in worm lipid extracts. The method provides high specificity and sensitivity by detecting the parent mass of the carboxylate anion together with unique product ions derived from collisional activation .

  • Multiple reaction monitoring (MRM): Using specific mass transitions (e.g., m/z 353/193 for PGF2α isomers and m/z 351/191 for PGF3-like compounds) enables detection of structurally-related prostaglandins synthesized by oocytes .

  • Prostaglandin microinjection assays: Direct injection of human PGF2α into the uterus of inx-14(RNAi) hermaphrodites followed by assessment of sperm velocity provides a functional test of prostaglandin signaling rescue .

  • Lipid extraction protocols: While specific details are not provided in the paper, proper extraction of prostaglandins from C. elegans tissues is critical for accurate quantification.

When implementing these approaches, researchers should include appropriate controls for extraction efficiency, use internal standards for quantification, and employ statistical methods that account for the variability inherent in lipid analysis. The combination of these biochemical approaches with genetic and cell biological methods provides a comprehensive understanding of INX-14's role in prostaglandin signaling .

How should researchers interpret the apparent contradiction between INX-14 localization and gap junction detection?

A significant contradiction in INX-14 research is that while immunocytochemistry shows INX-14 puncta at the sheath/germ cell interface in the distal gonad, transmission and freeze fracture electron microscopy has not detected gap junctions in this region. This presents an interpretive challenge for researchers .

When analyzing this contradiction, researchers should consider several possibilities:

  • Technical limitations: Gap junctions in the distal gonad may exist but be difficult to document using current electron microscopy techniques. INX-14 puncta at the sheath/germ cell interface appear similar to those at the sheath/oocyte interface in the proximal gonad, where gap junctions have been detected .

  • Alternative functions: INX-14 may function through channel-independent mechanisms in the distal gonad. This could involve conformational changes or adhesion-mediated processes rather than direct molecular transfer between cells .

  • Temporal dynamics: Gap junctions might be transient or have unique structural characteristics in the distal gonad that make them difficult to capture with standard fixation protocols.

  • Structural variations: Innexin-based channels in the distal gonad might have structural differences from conventional gap junctions that affect their detection.

Researchers investigating this contradiction should employ complementary approaches, including super-resolution microscopy, improved electron microscopy preparation techniques, and functional assays that can distinguish between channel-dependent and channel-independent mechanisms. The apparent contradiction should be viewed as an opportunity to discover novel aspects of innexin biology rather than simply a technical limitation .

What quantitative methods should be used to analyze INX-14's effects on sperm migration?

Analysis of INX-14's effects on sperm migration requires robust quantitative methods to capture the complex behavioral patterns of sperm cells. Based on the research approaches described, the following quantitative methods are recommended:

When implementing these methods, researchers should maintain consistent imaging conditions, include appropriate controls, and use sufficient sample sizes to account for biological variability. The combination of these quantitative approaches provides a comprehensive understanding of how INX-14 affects sperm migration behavior .

How can researchers determine whether INX-14 functions through channel-dependent or channel-independent mechanisms?

Distinguishing between channel-dependent and channel-independent functions of INX-14 represents a significant challenge in innexin research. The following methodological approaches can help researchers address this question:

  • Structure-function analysis: Creating mutations that specifically disrupt channel formation while preserving protein localization can help distinguish between these mechanisms. For example, mutations in pore-lining residues that block channel conductance without affecting protein folding or trafficking would be valuable tools .

  • Electrophysiological approaches: While challenging in C. elegans gonads, patch-clamp recordings or other electrophysiological techniques could potentially detect channel activity in cells expressing INX-14.

  • Dye transfer assays: Microinjection of fluorescent dyes that can pass through gap junctions (e.g., Lucifer Yellow) can assess functional coupling between cells. Absence of dye transfer despite INX-14 puncta would suggest channel-independent functions.

  • Molecular transfer experiments: Designing experiments to track the movement of specific molecules between sheath cells and germ cells could provide evidence for or against channel function.

  • High-resolution structural studies: Advanced imaging techniques such as cryo-electron microscopy could potentially resolve the structure of INX-14-containing complexes and determine whether they form channels.

  • Biochemical interaction studies: Identifying proteins that interact with INX-14 might reveal signaling partners involved in channel-independent functions.

The current evidence suggests two possibilities: either INX-14 forms gap junctions in the distal gonad that are difficult to document, or innexin-dependent contact between sheath cells and germ cells induces signal transduction independent of channel formation. Researchers should design experiments that can explicitly distinguish between these alternatives .

What are the most promising avenues for future INX-14 research?

Several promising research avenues could advance our understanding of INX-14 function:

  • Transcriptional regulation: Further investigation into how INX-14 regulates gene transcription in oocyte precursors could reveal novel signaling mechanisms. Identifying the specific transcriptional targets that mediate INX-14's effects on prostaglandin signaling would be particularly valuable .

  • Prostaglandin transport mechanisms: Evidence suggests INX-14 regulates prostaglandin signaling at a step after synthesis, possibly at the level of prostaglandin transport. Elucidating how INX-14 influences prostaglandin transport or activity in the reproductive tract represents an important research direction .

  • Structural studies: Determining the molecular structure of INX-14 channels and how they differ from conventional gap junctions could resolve the apparent contradiction between immunolocalization and electron microscopy findings .

  • Channel-independent functions: Investigating potential channel-independent functions of INX-14, such as adhesion-mediated signaling or conformational changes that trigger intracellular responses, could reveal novel aspects of innexin biology .

  • Interaction with other signaling pathways: Exploring how INX-14 signaling integrates with other pathways, particularly the DAF-16/FOXO pathway and prostaglandin signaling cascades, could provide insights into the broader signaling network regulating reproduction .

These research directions would benefit from interdisciplinary approaches combining genetics, cell biology, biochemistry, and structural biology to comprehensively understand INX-14 function .

How might findings from INX-14 research in C. elegans translate to other biological systems?

Findings from INX-14 research in C. elegans have potential implications for understanding related processes in other biological systems:

  • Mammalian reproduction: While mammals use connexins rather than innexins for gap junctions, the fundamental principles of intercellular communication in reproductive processes may be conserved. Understanding how INX-14 regulates prostaglandin signaling could provide insights into similar mechanisms in mammalian reproduction .

  • Pannexin biology: Innexins share structural and functional similarities with mammalian pannexins. Discoveries about channel-independent functions of INX-14 might inform research on pannexin signaling mechanisms in mammals .

  • Cellular communication in development: The role of INX-14 in communication between somatic cells (sheath) and germline cells has parallels in many developmental systems where soma-germline communication is critical. The signaling principles elucidated in this system may apply more broadly .

  • Transcriptional regulation by intercellular signaling: The finding that INX-14 influences transcriptional activity, particularly through DAF-16/FOXO factors, has parallels in many systems where intercellular communication regulates gene expression .

  • Prostaglandin signaling mechanisms: Insights into how INX-14 influences prostaglandin metabolism, transport, or activity could inform research on prostaglandin signaling in other contexts, including inflammation and pain perception .

Researchers should consider these broader implications when designing experiments and interpreting results from INX-14 studies, as they may have significance beyond C. elegans reproductive biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.