Recombinant Innexin-16 (inx-16)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant INX-16 is typically expressed in E. coli with an N-terminal His tag for affinity purification . Key parameters include:

ParameterSpecification
Host SystemE. coli (primary), yeast, baculovirus, or mammalian cells
Purity≥85–90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer (pH 8.0) at -80°C
Reconstitution0.1–1.0 mg/mL in sterile water with 50% glycerol for stability

Functional Roles in C. elegans

INX-16 is essential for intercellular communication in the intestine and body-wall muscles:

Key Phenotypes of inx-16 Mutants

PhenotypeMechanism
ConstipationDisrupted Ca²⁺ wave propagation between intestinal cells
Reduced brood sizeImpaired nutrient absorption due to defecation defects
Electrical coupling deficiencyLoss of gap junction function in body-wall muscles

Interactions

  • Forms homotypic channels in intestinal cells .

  • Collaborates with INX-11 for electrical coupling in muscles .

Research Applications

Recombinant INX-16 is widely used to study:

ApplicationExperimental Findings
Gap junction permeabilityINX-6 (homolog) channels allow passage of 3–10 kDa tracers, larger than connexins .
Calcium signalingRequired for intestinal Ca²⁺ waves regulating defecation cycles .
Protein interaction mappingUNC-1 modifies UNC-9 channels; analogous modifiers may exist for INX-16 .

Key Research Findings

  1. Role in Defecation
    INX-16 enables synchronized Ca²⁺ waves across intestinal cells, which drive rhythmic muscle contractions. Mutants exhibit constipation due to disrupted Ca²⁺ flux .

  2. Electrical Coupling
    INX-16 contributes to body-wall muscle coupling alongside INX-11, INX-1, and INX-10. Double mutants show additive coupling defects .

  3. Biophysical Properties

    • Forms hexameric channels with ~140 Å diameter (vs. 92 Å for connexin26) .

    • Functional in insect cells (Sf9) but not mammalian HeLa cells, suggesting species-specific modifiers .

Limitations and Future Directions

  • Challenges: Recombinant INX-16::GFP fusion proteins often form intracellular aggregates, limiting functional studies .

  • Opportunities: High-resolution structural studies (e.g., cryo-EM) could elucidate channel gating mechanisms.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All protein shipments default to standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
inx-16; opu-16; R12E2.5; Innexin-16; Protein opu-16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-372
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
inx-16
Target Protein Sequence
MSMLGNIKTYAQTVTSLSDNDDTSIDRLNYVVTTSILIAFSLLLFAKNYVGEPMQCWTPN QFAGGWESFAESYCFIENTYFVPMQDSNLPAAETREGREMIYYQWVPFLLVIQALFFCVP RAFWIIYPSYSGLTIADMITAARQNGKQLEGADEALEQVAMINWRTEQQKGHGSRIFNCY LVMKLLILLNIVLQFFLLNSFLNTAYTFWGWGIFWDMVNGRHWQESGHFPRVSFCDINVR ELGNIHHWSLQCVLMVNMFNEKIFIFLWFWFAFLLVATAGDFVIWVWRRFDSNSKLGFIL DLLNQEGIDHSPQKASELYKNVLRDDGVLFLRLLDSNSGRLNSEELMKKIYNISVGHATD LNTPIEEHATSE
Uniprot No.

Target Background

Function
Innexin-16 is a structural component of gap junctions and plays a crucial role in signaling downstream of the defecation clock (Ref.2).
Gene References Into Functions
  1. Normal wave propagation requires the pannexin gap-junction subunit INX-16 at the interfaces of the intestinal cells. PMID: 17825560
Database Links

KEGG: cel:CELE_R12E2.5

STRING: 6239.R12E2.5

UniGene: Cel.38915

Protein Families
Pannexin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is Innexin-16 and what is its function in C. elegans?

Innexin-16 (inx-16) is a gap junction protein expressed in the intestine of C. elegans that localizes to cell-cell contacts between intestinal cells. It forms homotypic channels that allow calcium waves to propagate throughout the intestine, which is essential for proper intestinal muscle contractions and defecation cycles. Mutants lacking functional INX-16 display constipation, reduced size, slower growth, and decreased reproductive capacity compared to wild-type worms . The protein is encoded by the gene also known as opu-16 or R12E2.5 .

How does INX-16 differ from other innexins in C. elegans?

While C. elegans contains 25 innexin genes expressed in various tissues, INX-16 has specific expression in the intestine. Unlike some other intestinal innexins (inx-2, inx-11, and inx-15), INX-16 appears specifically critical for calcium wave propagation. Interestingly, the inx-16 mutant blocks endogenous fluorescent marker spread in the intestine (preceded by calcium waves) but does not inhibit Lucifer Yellow dye transfer between intestinal cells, suggesting functional specialization even among intestinal innexins .

What expression systems are commonly used for producing Recombinant INX-16?

Recombinant INX-16 can be produced using several expression systems, including E. coli, yeast, baculovirus-infected insect cells, mammalian cells, and cell-free expression systems. Each system offers different advantages for protein folding, post-translational modifications, and yield. For gap junction proteins like innexins, insect and mammalian expression systems often provide better functional properties due to their ability to perform complex eukaryotic protein processing .

What is the recommended protocol for expressing and purifying Recombinant INX-16?

Based on successful protocols for related innexins such as INX-6, a recommended approach would include:

  • Clone the full-length C. elegans inx-16 gene into an expression vector such as pFastBac1

  • Add a purification tag (His6 or GFP-His) with a thrombin cleavage site at the C-terminus

  • Generate recombinant baculoviruses and infect Sf9 insect cells

  • Harvest cells after 24-30 hours of infection

  • Prepare membranes by sonication in buffer (10 mM Tris pH 7.5, 150 mM NaCl, 1 mM PMSF)

  • Solubilize membranes in 1% DDM detergent

  • Purify using nickel-nitrilotriacetic acid-agarose

  • Elute with 300 mM L-histidine

  • Verify purity using SDS-PAGE and Western blotting

How can researchers assess the functionality of recombinant INX-16 gap junction channels?

Functionality of recombinant INX-16 channels can be assessed using multiple approaches:

  • Dye transfer assays: Microinjection of fluorescent tracers of different molecular weights (e.g., SR101, 3k-TR, 10k-TR) into cells expressing INX-16 to determine channel permeability characteristics

  • Electrophysiology: Patch-clamp recordings to measure electrical coupling between INX-16 expressing cells

  • Calcium imaging: Using calcium-sensitive dyes to visualize calcium wave propagation through INX-16 channels

  • Structural analysis: Negative stain electron microscopy to visualize gap junction plaques formed by INX-16

What quality control methods ensure optimal purity and functionality of Recombinant INX-16?

Standard quality control procedures should include:

  • SDS-PAGE analysis to confirm ≥85% purity

  • Western blotting with anti-His antibodies (if His-tagged)

  • Size exclusion chromatography to assess oligomeric state

  • Functional assays in expression systems (dye transfer)

  • Negative stain electron microscopy to confirm formation of gap junction-like structures

How does the channel permeability of INX-16 compare to other gap junction proteins?

While specific permeability data for INX-16 is limited in the provided search results, related innexins like INX-6 demonstrate interesting permeability characteristics. INX-6 channels have a larger diameter (~140 Å) compared to vertebrate connexins (92 Å for connexin26) and allow passage of larger tracers (up to 3 kDa and some 10 kDa molecules). This suggests innexins may generally form larger pores with different permeability profiles than vertebrate gap junction proteins. Similar comparative studies with INX-16 would be valuable for understanding its specific permeability characteristics .

What are the challenges in distinguishing between the channel and adhesive functions of INX-16?

Gap junction proteins like INX-16 serve dual roles in intercellular communication and cell adhesion. Experimental approaches to distinguish these functions might include:

  • Utilizing channel-blocking reagents that don't disrupt physical interactions

  • Creating INX-16 mutants with altered pore properties but intact structural domains

  • Analyzing INX-16 function in adhesion-independent assays

  • Comparing wild-type and mutant INX-16 using both dye transfer and adhesion assays

  • Employing high-resolution imaging to correlate gap junction plaque formation with functional coupling

The search results highlight that "disentangling the adhesive and channel functions of gap junctions is a complex issue," suggesting this remains an active research challenge .

What experimental approaches can determine if INX-16 forms heteromeric or heterotypic channels with other innexins?

Since multiple innexins (inx-2, inx-11, inx-15) are expressed alongside INX-16 in the intestine, researchers may want to investigate potential heteromeric/heterotypic interactions using:

  • Co-immunoprecipitation of differentially tagged innexins

  • Förster resonance energy transfer (FRET) between fluorescently labeled innexins

  • Electrophysiological characterization of cells expressing multiple innexins

  • Single-molecule imaging techniques to visualize channel composition

  • Genetic approaches using various innexin mutant combinations to assess functional compensation

What factors affect the expression and stability of Recombinant INX-16?

Based on studies with related innexins, researchers should consider:

  • Expression system compatibility: While INX-6 formed gap junctions in insect Sf9 cells, it failed to form them in mammalian HeLa cells, suggesting system-specific requirements for proper assembly

  • Post-translational modifications: Potential requirement for specific modifications for channel formation

  • Temperature sensitivity: Some innexin mutants (e.g., inx-6) show cold sensitivity, suggesting temperature may affect folding and stability

  • C-terminal modifications: Point mutations in non-conserved C-terminal regions of related innexins dramatically impact function, indicating this region's importance for protein stability and function

What are common pitfalls when working with membrane proteins like INX-16?

Common challenges include:

  • Protein aggregation: Membrane proteins can aggregate during purification

  • Detergent selection: Finding the optimal detergent that maintains protein stability and function

  • Expression levels: Membrane protein overexpression can overwhelm cellular machinery

  • Functional assessment: Ensuring the recombinant protein maintains native functionality

  • Structural integrity: Preserving the quaternary structure during purification

For INX-16 specifically, researchers should note that the apparent molecular weight on SDS-PAGE may differ from the calculated weight (as observed with INX-6, which appeared at ~37 kDa instead of the expected 45 kDa) .

How do C. elegans innexins like INX-16 compare structurally and functionally to vertebrate connexins?

Despite lacking primary sequence homology, innexins and connexins share striking structural and functional similarities:

  • Both form hexameric hemichannels that dock to create intercellular channels

  • Both contain four transmembrane domains with cytoplasmic N and C termini

  • Innexin-based gap junctions typically have larger channel diameters (~140 Å for INX-6 vs 92 Å for connexin26)

  • Innexin channels may have greater permeability to larger molecules compared to connexin channels

  • Both protein families demonstrate tissue-specific expression patterns and form gap junction plaques at cell-cell interfaces

What can comparative studies between different innexin family members tell us about INX-16 function?

Comparative approaches reveal:

  • Functional specialization: Despite structural similarities, innexins like INX-16 and INX-6 have non-redundant functions

  • Expression patterns: Different innexins show tissue-specific and developmentally regulated expression

  • Channel properties: Variations in permeability and gating properties between innexin family members

  • Genetic interactions: Some innexins can partially substitute for others (e.g., EAT-5 partially substituting for INX-6), providing insights into functional domains

  • Evolutionary conservation: Comparison with innexins in other invertebrates like Lymnaea stagnalis can highlight conserved regions essential for function

What emerging technologies might advance our understanding of INX-16 function?

Promising approaches include:

  • Cryo-electron microscopy: For high-resolution structural analysis of INX-16 channels

  • Optogenetic tools: To manipulate INX-16 channel activity with spatial and temporal precision

  • CRISPR-Cas9 genome editing: For creating precise mutations to study structure-function relationships

  • Single-molecule imaging: To study the dynamics of INX-16 channel assembly and gating

  • Computational modeling: To predict channel properties and interactions with other cellular components

What are the potential applications of understanding INX-16 function beyond basic research?

Understanding INX-16 and innexin biology has broader implications for:

  • Drug development: Gap junction modulators as potential therapeutics

  • Synthetic biology: Engineering communication networks in cellular systems

  • Disease modeling: Understanding communication defects in pathological conditions

  • Comparative physiology: Insights into conserved mechanisms of intercellular communication

  • Biotechnology: Development of biosensors based on gap junction properties

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.