Recombinant Innexin-17 (inx-17)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
inx-17; opu-17; R12E2.4; Innexin-17; Gap junction innexin; Protein opu-17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-362
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
inx-17
Target Protein Sequence
MKIDTGFYSKTITPTYDSDAIDRLRYYFTVFLLTSSAFFIMAKQYVGQSIQCWAPKQFKG GWEEYAESYCLIENTYYVHMNNSNLPGPAIRENKELKYYQWVPFILFGLAVVIYIPRVIW NALQSLIGINISIVTSNLRKVAKSGFTSENPDIEKKKKEMQCKKKATSRQVDGEFWGSRL TTCILATKFLATILIFISMGFLDYFMGLGPMYGWTITKDILQGRQWQESGSFPRVTFCDF QVRELGYVNNWSLQCVLMVNMFNEKLFIALWWWYALLAILSIFDIFRVLFRFTIHHQISF ITRILACTGDSAISATEVGEFNRKVLRIDGINLTHLVYANATIFEAADFVRPMWEQFKEN QN
Uniprot No.

Target Background

Function
A structural component of gap junctions.
Database Links

KEGG: cel:CELE_R12E2.4

STRING: 6239.R12E2.4a.2

UniGene: Cel.19417

Protein Families
Pannexin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What are the known expression patterns of innexin-17 in model organisms?

Innexin-17 expression patterns can be studied using techniques similar to those used for other innexins. In C. elegans, where multiple innexins have been characterized, expression patterns are typically tissue-specific, with innexins such as UNC-9 and INX-18 being expressed in body-wall muscle cells . For studying innexin-17 expression, researchers commonly employ RT-PCR to detect mRNA in specific tissues, followed by in situ hybridization to visualize expression patterns in intact organisms. Immunofluorescence staining using specific antibodies against innexin-17, similar to methods used for innexin-2 in Hydra, can reveal the subcellular localization of the protein . Expression analysis should include developmental time courses to identify temporal regulation patterns, as gap junction communication often varies throughout development.

How do I design primers for cloning the cDNA of innexin-17?

When designing primers for cloning innexin-17 cDNA, follow the approach used for other innexins by designing primer pairs complementary to the 5'- and 3'-ends of the target sequence . Start by consulting genomic databases such as WormBase for C. elegans innexins to identify the longest reported isoform of innexin-17. If multiple isoforms are predicted, design primers that can capture all potential splice variants. For improved amplification specificity:

  • Design primers with a GC content of 40-60%

  • Ensure primer melting temperatures are within 5°C of each other

  • Check for self-complementarity and potential hairpin formation

  • Add restriction enzyme sites to the 5' ends for downstream cloning

For challenging templates, compare genomic sequences between closely related species (e.g., C. elegans and C. briggsae) to identify conserved regions, as was done for other innexin genes . After RT-PCR amplification, sequence the products to identify potential novel isoforms, as multiple cDNA isoforms have been identified for other innexins such as INX-1, INX-10, and INX-11 .

What expression systems are most effective for producing recombinant innexin-17?

The optimal expression system for recombinant innexin-17 depends on your downstream applications. For structural studies and antibody production, bacterial expression systems like E. coli BL21(DE3) can be effective for producing specific domains, such as the extracellular loops . For full-length functional innexin-17, eukaryotic expression systems are preferred due to the protein's multiple transmembrane domains and potential post-translational modifications.

For bacterial expression:

  • Clone specific domains (preferably the first extracellular loop) into vectors like pET28a

  • Transform into E. coli BL21(DE3) strain

  • Induce expression with IPTG

  • Purify using affinity chromatography (Ni-NTA for His-tagged constructs)

For mammalian or insect cell expression of full-length protein:

  • Use vectors with strong promoters (CMV for mammalian cells, polyhedrin for baculovirus)

  • Add fluorescent tags (EGFP) at the C-terminus to monitor expression and localization

  • Optimize codon usage for the expression system

  • Consider using inducible expression systems to mitigate potential toxicity

The heterologous expression of membrane proteins like innexins remains challenging, and optimization of culture conditions (temperature, induction time, inducer concentration) is typically required for each construct .

What are the key considerations for designing constructs for recombinant innexin-17?

When designing constructs for recombinant innexin-17, several factors should be considered to ensure proper expression and functionality:

  • Domain selection: For antibody production or domain-specific studies, expressing the first extracellular loop (as done for innexin-2 in Hydra) is often effective . For functional studies, full-length constructs are necessary.

  • Fusion tags:

    • N-terminal tags may interfere with signal peptide function

    • C-terminal tags are generally preferable for membrane proteins

    • His6 tags facilitate purification via Ni-NTA chromatography

    • GFP fusion can help monitor expression and localization

  • Codon optimization: Adjust codon usage for your expression system to enhance translation efficiency.

  • Membrane topology: Preserve the natural topology of the protein by careful placement of tags and fusion partners.

  • Mutagenesis considerations:

    • Include sites for site-directed mutagenesis to study structure-function relationships

    • Consider introducing stop codons for truncation studies, as was done with innexin-2

    • Create chimeric constructs with well-characterized innexins to study domain functions

  • Cloning strategy: Include appropriate restriction sites for subcloning into different expression vectors, allowing flexibility in expression systems .

A modular cloning approach that allows easy transfer between different expression systems provides the most flexibility for different experimental applications.

How do I generate specific antibodies against innexin-17?

Generating specific antibodies against innexin-17 requires careful antigen design and validation. Based on successful approaches with other innexins:

  • Antigen selection:

    • The first extracellular loop is an ideal target, as demonstrated for innexin-2 (amino acids 48-134)

    • Avoid regions with high sequence similarity to other innexin family members

    • Synthesize or express the selected peptide region in E. coli using vectors like pET28a

  • Protein purification:

    • Purify the recombinant peptide using affinity chromatography (Ni-NTA for His-tagged proteins)

    • Verify purity by SDS-PAGE before immunization

    • For further purification, isolate the target band from the gel

  • Immunization and antibody production:

    • Use rabbits for polyclonal antibodies

    • Consider species cross-reactivity if studying innexins across different model organisms

    • Affinity-purify the resulting antibodies using protein A-Sepharose

  • Validation steps:

    • Western blot against recombinant protein and tissue lysates

    • Immunofluorescence in tissues with known expression

    • Negative controls using pre-immune serum and tissues from knockdown animals

    • Peptide competition assays to confirm specificity

Careful validation is essential as cross-reactivity with other innexin family members can lead to misinterpretation of results .

What are the best methods for validating the specificity of innexin-17 antibodies?

Validating the specificity of innexin-17 antibodies requires a multi-pronged approach:

  • Molecular validation:

    • Western blot against recombinant innexin-17 protein to confirm recognition

    • Comparative Western blots with other recombinant innexin proteins to check for cross-reactivity

    • Peptide competition assays where pre-incubation with the immunizing peptide should abolish signal

  • Cellular validation:

    • Immunofluorescence in cells overexpressing tagged innexin-17

    • Colocalization with known gap junction markers

    • Absence of signal in cells lacking innexin-17 expression

  • Tissue validation:

    • Immunohistochemistry patterns should match mRNA expression determined by in situ hybridization

    • Reduced or absent staining in tissues from innexin-17 knockdown animals

    • Electron microscopy to confirm labeling of gap junction structures

  • Functional validation:

    • Antibody addition to live cells/tissues should disrupt gap junction communication if the antibody targets functional domains

    • Similar functional disruption has been observed with innexin-2 antibodies in Hydra, where treatment eliminated gap junction staining and reduced spontaneous contractions

Proper validation ensures that experimental results genuinely reflect innexin-17 biology rather than artifacts or cross-reactions with other innexin family members.

What electrophysiological methods are most suitable for studying innexin-17 function?

Electrophysiological characterization of innexin-17 channels should build upon established methods used for other innexins:

  • Dual whole-cell patch-clamp recordings:

    • This technique allows measurement of junctional conductance (Gj) between coupled cells

    • Use cell pairs expressing recombinant innexin-17 or isolated from tissues known to express the protein

    • Apply voltage steps to one cell while recording current in the adjacent cell

    • Analyze the resulting conductance measurements to determine channel properties

  • Single channel recordings:

    • Isolate individual channel activity using patch-clamp techniques

    • Determine conductance states, voltage sensitivity, and gating properties

    • Compare with other characterized innexins such as UNC-9, which shows specific conductance properties in C. elegans muscle cells

  • Voltage clamp protocols:

    • Design protocols to assess voltage-dependent gating

    • Test transjunctional voltage sensitivity

    • Evaluate channel permeability to different ions and small molecules

  • Advanced techniques:

    • Combined electrophysiology and fluorescence imaging to correlate channel function with protein localization

    • Optical methods using voltage-sensitive dyes to assess coupling in intact tissues

Results should be quantified as junctional conductance (Gj) and compared between wild-type and mutant innexin-17 to establish structure-function relationships, following the approach used for analyzing innexin mutants in C. elegans .

How can I determine if innexin-17 forms homotypic or heterotypic gap junctions?

Determining whether innexin-17 forms homotypic junctions (between identical innexins) or heterotypic/heteromeric junctions (with other innexin family members) requires a systematic approach:

  • Expression systems:

    • Express innexin-17 alone or in combination with other innexins in communication-deficient cells

    • Use inducible or differentially tagged constructs to control expression of different innexins

  • Electrophysiological assessment:

    • Compare junctional conductance (Gj) between cells expressing innexin-17 alone versus cells co-expressing innexin-17 with other innexins

    • If two innexins function together in heterotypic/heteromeric channels, Gj in double mutants would be comparable to single mutants, as observed with UNC-9 and INX-18 in C. elegans

    • If they form independent channels, Gj would decrease more dramatically in double mutants

  • Biochemical approaches:

    • Co-immunoprecipitation to detect physical interactions between innexin-17 and other innexins

    • Proximity ligation assays to visualize protein interactions in situ

    • Blue native PAGE to identify oligomeric complexes containing multiple innexin types

  • Microscopy techniques:

    • FRET between differently tagged innexins to detect close molecular proximity

    • Super-resolution microscopy to visualize co-localization at gap junction plaques

    • Electron microscopy combined with immunogold labeling to identify heterotypic junctions

Systematic analysis of innexin-17 interaction with other innexins, similar to the analyses performed for innexins in C. elegans muscle, will reveal whether it forms distinct channel populations or contributes to existing heteromeric channels .

What are effective strategies for RNA interference (RNAi) of innexin-17?

Effective RNAi targeting of innexin-17 requires careful design and optimization based on successful approaches used for other innexins:

  • Target sequence selection:

    • Choose 500-700 bp fragments specific to innexin-17, avoiding regions with significant homology to other innexins

    • For Drosophila, fragments of approximately 500-600 bp have been effective, as demonstrated with innexin-3 (620 bp fragment)

    • Target conserved regions for higher knockdown efficiency

    • Use algorithms to predict efficient siRNA sequences within your fragment

  • Delivery methods:

    • For C. elegans: feeding, soaking, or injection methods can be employed

    • For Drosophila: both direct dsRNA injection and transgenic RNAi constructs have proven effective

    • For direct injections, purify dsRNA using in vitro transcription systems like RiboMax Express

    • For stable knockdown, consider transgenic approaches using vectors like pWIZ, which allow tissue-specific expression of inverted repeats

  • Controls and validation:

    • Include buffer-only or non-targeting dsRNA controls

    • Quantify knockdown efficiency using qRT-PCR, Western blot, or immunostaining

    • Monitor potential off-target effects on closely related innexins

  • Phenotypic analysis:

    • Assess tissue-specific effects related to gap junction function

    • For developmental studies, analyze embryonic phenotypes following procedures similar to those used for innexin-3 in Drosophila

    • For functional studies, measure electrical coupling, dye transfer, or tissue-specific behaviors

The effectiveness of RNAi can vary considerably between tissues and developmental stages, so optimization for your specific experimental context is essential .

How can CRISPR/Cas9 be used to study innexin-17 function?

CRISPR/Cas9 offers powerful approaches for studying innexin-17 function through precise genomic modification:

  • Knockout strategies:

    • Design guide RNAs targeting early exons to create frameshift mutations

    • Target multiple sites simultaneously to ensure complete loss of function

    • For conditional knockout, use tissue-specific Cas9 expression or floxed alleles with tissue-specific Cre

  • Knockin approaches:

    • Create fluorescent protein fusions at the endogenous locus to study expression and localization

    • Introduce specific mutations to study structure-function relationships

    • Generate epitope tags for biochemical studies when antibodies are limiting

  • Guide RNA design considerations:

    • Select targets with minimal off-target potential

    • Consider the genomic structure of innexin-17, targeting conserved exons

    • Design repair templates with homology arms of appropriate length (≥500 bp)

  • Functional validation methods:

    • Confirm editing by sequencing and expression analysis

    • Conduct electrical coupling assays similar to those used to characterize innexin mutants in C. elegans

    • Assess phenotypes in the context of known gap junction functions in your model system

    • Perform rescue experiments with wild-type innexin-17 to confirm specificity

  • Complementary approaches:

    • Combine with tissue-specific rescue to map functional requirements

    • Use domain swaps with other innexins to identify functional domains

    • Create allelic series to distinguish hypomorphic from null phenotypes

CRISPR/Cas9-generated mutations provide more stable and specific disruption of innexin-17 function compared to RNAi, facilitating detailed analysis of its physiological roles.

How can I investigate if innexin-17 belongs to distinct functional populations of gap junctions?

Investigating whether innexin-17 belongs to distinct functional populations of gap junctions requires a systematic approach similar to that used for other innexins in C. elegans:

  • Genetic interaction analysis:

    • Generate single and double mutants of innexin-17 with other innexins

    • Measure junctional conductance (Gj) in these genetic backgrounds

    • Compare Gj between single and double mutants; if Gj in the double mutant is similar to single mutants, the innexins likely function together in the same population

    • If Gj is further decreased in double mutants, they likely form separate channel populations

  • Electrophysiological characterization:

    • Compare channel properties (conductance, voltage sensitivity, gating) between innexin-17 and other innexins

    • Distinct channel properties may indicate separate functional populations

    • Analyze the effects of specific blockers or modulators on different innexin channels

  • Co-localization studies:

    • Use high-resolution imaging to determine if innexin-17 co-localizes with other innexins at gap junction plaques

    • Employ super-resolution techniques to resolve potentially distinct populations within the same cellular regions

    • Quantify co-localization coefficients to determine the degree of overlap

  • Tissue-specific rescue experiments:

    • Restore innexin-17 expression in specific tissues in mutant backgrounds

    • Determine if this rescues the function of particular gap junction populations

    • Compare with rescue using other innexins to identify functional equivalence or distinction

This systematic analysis, similar to that which revealed two distinct populations of gap junctions in C. elegans muscle (one containing UNC-9/INX-18 and another containing INX-1/INX-10/INX-11/INX-16), will reveal innexin-17's functional grouping .

What approaches can be used to study post-translational modifications of innexin-17?

Post-translational modifications (PTMs) of innexins can significantly affect channel assembly, trafficking, and function. To study PTMs of innexin-17:

  • Identification of modification sites:

    • Mass spectrometry analysis of purified recombinant or native innexin-17

    • Enrichment strategies for specific PTMs (e.g., phospho-enrichment, glycopeptide enrichment)

    • Bioinformatic prediction of potential modification sites based on consensus sequences

  • Site-directed mutagenesis:

    • Mutate predicted modification sites (e.g., S/T→A for phosphorylation, K→R for ubiquitination)

    • Express mutant proteins in heterologous systems or through genome editing in model organisms

    • Assess effects on protein localization, stability, and channel function

  • Modification-specific antibodies:

    • Generate antibodies that specifically recognize modified forms of innexin-17

    • Use these for immunofluorescence to determine subcellular localization of modified proteins

    • Employ Western blotting to quantify modification levels under different conditions

  • Pharmacological approaches:

    • Use kinase or phosphatase inhibitors to manipulate phosphorylation state

    • Apply glycosylation inhibitors to assess the role of glycosylation

    • Examine effects of proteasome or lysosome inhibitors on protein turnover

  • Dynamic studies:

    • Investigate changes in modifications during development or in response to physiological stimuli

    • Use pulse-chase experiments to track the fate of modified proteins

    • Apply FRAP (Fluorescence Recovery After Photobleaching) to study the dynamics of modified proteins at gap junctions

Understanding the post-translational regulation of innexin-17 will provide insights into the dynamic regulation of gap junction communication in specific physiological contexts.

How do I analyze and interpret electrophysiological data from innexin-17 gap junctions?

Analysis and interpretation of electrophysiological data from innexin-17 gap junctions should follow established principles used for other innexins:

  • Junctional conductance (Gj) measurements:

    • Calculate Gj using Ohm's law from dual whole-cell patch-clamp recordings

    • Compare Gj between wild-type and mutant innexin-17 channels

    • Analyze how Gj changes in response to transjunctional voltage, pH, or calcium concentrations

    • Use statistical methods to determine significant differences between experimental conditions

  • Channel kinetics analysis:

    • Extract opening and closing rates from single-channel recordings

    • Determine mean open and closed times

    • Calculate open probability under different conditions

    • Fit data to appropriate kinetic models to extract gating parameters

  • Voltage dependence characterization:

    • Plot Gj versus transjunctional voltage (Vj)

    • Fit data to Boltzmann equations to extract gating parameters

    • Compare voltage sensitivity with other innexin channels

  • Permeability studies:

    • Analyze dye transfer rates for fluorescent tracers of different molecular weights and charges

    • Calculate permeability ratios for different ions

    • Compare selectivity profiles with other characterized innexins

  • Data interpretation considerations:

    • Consider the cellular context when interpreting in vitro versus in vivo measurements

    • Account for potential compensatory effects in genetic models

    • Evaluate how heteromerization with other innexins may affect channel properties

Systematic analysis and comparison with data from other innexins, such as the conductance measurements from C. elegans muscle innexins, will help place innexin-17 in the functional context of gap junction diversity .

What statistical approaches are most appropriate for analyzing innexin-17 mutant phenotypes?

Selecting appropriate statistical approaches for analyzing innexin-17 mutant phenotypes is crucial for robust data interpretation:

  • For electrophysiological data:

    • Use paired t-tests for before/after comparisons in the same cells

    • Apply ANOVA with post-hoc tests for comparing multiple genotypes or conditions

    • Use non-parametric tests (Mann-Whitney, Kruskal-Wallis) if data do not follow normal distributions

    • Report both p-values and effect sizes to indicate both statistical and biological significance

  • For behavioral phenotypes:

    • Analyze frequency data (e.g., contraction rates) using appropriate time-series methods

    • Apply survival analysis techniques for developmental timing phenotypes

    • Use repeated measures designs when tracking the same animals over time

  • For imaging and localization data:

    • Employ quantitative colocalization metrics (Pearson's coefficient, Manders' overlap)

    • Use intensity correlation analysis for protein interaction studies

    • Apply automated image analysis to eliminate observer bias

  • For genetic interaction analysis:

    • Use factorial ANOVA to detect interaction effects between multiple innexin mutations

    • Apply regression models to quantify additive versus synergistic effects

    • Consider Bayesian approaches for complex genetic interactions

  • Experimental design considerations:

    • Include power analysis to determine appropriate sample sizes

    • Use randomization and blinding where possible

    • Include multiple control groups (positive and negative) for robust interpretation

    • Consider sources of biological variability (developmental stage, sex, genetic background)

Proper statistical analysis will help distinguish genuine innexin-17 phenotypes from experimental artifacts and reveal significant interactions with other innexins or cellular components .

What are common challenges in expressing recombinant innexin-17 and how can they be overcome?

Expressing recombinant innexins presents several challenges due to their multiple transmembrane domains. Common issues and solutions include:

  • Low expression levels:

    • Optimize codon usage for the expression system

    • Test different promoters and expression vectors

    • Use specialized strains designed for membrane protein expression

    • Lower induction temperature (16-20°C) to allow proper folding

    • Consider using fusion partners that enhance solubility (MBP, SUMO)

  • Protein aggregation:

    • Include appropriate detergents during extraction and purification

    • Screen different detergents (DDM, LMNG, digitonin) for optimal solubilization

    • Add stabilizing agents such as glycerol or specific lipids

    • Express only soluble domains (e.g., the first extracellular loop) for certain applications, as was done successfully for innexin-2

  • Improper folding:

    • Use eukaryotic expression systems for full-length protein

    • Consider insect cell or mammalian cell expression for proper post-translational modifications

    • Include chaperones to assist folding

    • Test different cell lines for optimal expression

  • Purification difficulties:

    • Use tandem affinity tags for increased purity

    • Apply size exclusion chromatography to separate aggregates

    • Consider on-column refolding for proteins expressed in inclusion bodies

    • Optimize buffer conditions (pH, salt, additives) for stability during purification

  • Verification approaches:

    • Use Western blotting to confirm expression and molecular weight

    • Employ circular dichroism to assess secondary structure

    • Apply mass spectrometry to verify protein identity and modifications

    • Test functionality using dye transfer or electrophysiological assays in reconstituted systems

These strategies, adapted from successful approaches with other innexins, can help overcome the inherent challenges of membrane protein expression .

How can I troubleshoot antibody cross-reactivity with other innexin family members?

Antibody cross-reactivity is a common challenge when working with protein families like innexins. To address this issue:

  • Epitope selection:

    • Choose unique regions with low sequence similarity to other innexins

    • Avoid conserved domains, particularly the transmembrane regions

    • Focus on variable regions like cytoplasmic loops or C-terminus

    • Use sequence alignment tools to identify innexin-17-specific regions

  • Validation strategies:

    • Test antibodies against recombinant proteins of multiple innexin family members

    • Perform Western blots on tissues from innexin-17 knockout/knockdown models

    • Use peptide competition assays with both target and potential cross-reactive peptides

    • Validate staining patterns with mRNA expression data from in situ hybridization

  • Purification approaches:

    • Affinity-purify antibodies against the specific immunizing peptide

    • Perform negative selection against peptides from related innexins

    • Use protein A-Sepharose for initial purification, followed by antigen-specific affinity purification

  • Alternative methods:

    • Consider epitope tagging innexin-17 using CRISPR/Cas9 knock-in strategies

    • Use commercial tag-specific antibodies with validated specificity

    • Employ proximity labeling approaches (BioID, APEX) to identify interacting proteins without relying on direct antibody detection

    • Develop nanobodies with higher specificity for closely related epitopes

  • Cross-reactivity documentation:

    • Thoroughly document any observed cross-reactivity

    • Include appropriate controls in all experiments

    • Be transparent about antibody limitations in publications

These approaches will help minimize misinterpretation of results due to antibody cross-reactivity issues, which is particularly important for studying specific innexin functions in complex tissues .

What are promising areas for future research on innexin-17 function?

Future research on innexin-17 should build upon our understanding of other innexins while addressing specific gaps in knowledge:

  • Physiological roles:

    • Investigate tissue-specific functions using conditional knockout approaches

    • Examine potential roles in electrical coupling of excitable cells, similar to innexin-2 in Hydra nerve cells

    • Explore developmental functions through stage-specific manipulations

    • Investigate potential roles in regeneration and wound healing

  • Structural biology:

    • Determine high-resolution structures using cryo-EM or X-ray crystallography

    • Analyze conformational changes during channel gating

    • Compare structural features with other characterized innexins to identify functional domains

    • Investigate the structural basis of selectivity and permeability

  • Interaction networks:

    • Identify proteins that interact with innexin-17 using proximity labeling or co-immunoprecipitation

    • Map regulatory pathways that control innexin-17 expression, trafficking, and function

    • Investigate heteromerization with other innexins, similar to studies in C. elegans muscle

    • Analyze interactions with scaffolding proteins or cytoskeletal elements

  • Comparative biology:

    • Compare innexin-17 function across different invertebrate species

    • Investigate evolutionary relationships between innexins and connexins

    • Explore potential functional overlap with pannexins in higher organisms

  • Therapeutic applications:

    • Explore the potential of targeting innexin-17 for pest control in agricultural contexts

    • Investigate innexin-based peptides as modulators of gap junction communication

    • Develop tools to specifically modulate innexin-17 channels in vivo

These research directions will advance our understanding of innexin-17's specific contributions to gap junction diversity and function across invertebrate species .

How can emerging technologies be applied to study innexin-17 structure and function?

Emerging technologies offer exciting opportunities to advance innexin-17 research:

  • Cryo-electron microscopy:

    • Determine high-resolution structures of innexin-17 gap junction channels

    • Visualize conformational changes during gating

    • Study heteromeric assemblies with other innexins

    • Compare structural details with connexin and pannexin channels

  • Gene editing technologies:

    • Apply CRISPR/Cas9 for precise genomic engineering

    • Create conditional alleles for tissue-specific functional analysis

    • Develop knock-in reporters for live imaging of expression dynamics

    • Generate comprehensive allelic series to dissect structure-function relationships

  • Single-cell technologies:

    • Use single-cell transcriptomics to map innexin-17 expression at unprecedented resolution

    • Apply patch-seq to correlate electrophysiological properties with transcriptional profiles

    • Implement spatial transcriptomics to understand tissue context of expression

  • Advanced imaging:

    • Apply super-resolution microscopy (STORM, PALM) to visualize gap junction architecture

    • Use live imaging with voltage-sensitive fluorophores to correlate structure with function

    • Implement optogenetic tools to control gap junction activity with light

    • Develop FRET-based sensors to monitor gap junction opening in real time

  • Computational approaches:

    • Apply molecular dynamics simulations to predict channel properties and gating mechanisms

    • Use machine learning to identify patterns in electrophysiological data

    • Develop predictive models of gap junction network function in tissues

    • Implement systems biology approaches to understand how gap junctions integrate with other signaling mechanisms

These technologies will enable researchers to address fundamental questions about innexin-17 biology that were previously intractable with conventional approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.