Recombinant Innexin-19 (inx-19)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Neuronal Development

INX-19 is essential for establishing left-right asymmetry in the AWC olfactory neurons during embryogenesis . Key findings include:

  • Gap Junction Networks: Forms transient electrical synapses between embryonic neurons, enabling calcium wave propagation critical for asymmetric gene expression .

  • Mutant Phenotypes:

    • inx-19 loss-of-function mutants exhibit two AWC OFF neurons (symmetric signaling) .

    • Overexpression results in two AWC ON neurons, confirming its role in asymmetry .

  • Calcium Signaling: Buffering intracellular calcium disrupts asymmetry, linking INX-19 to calcium-dependent signaling .

Role in Sensory Modulation

INX-19 modulates nociceptive responses via electrical synapses in adult C. elegans:

  • Quinine Sensitivity:

    • inx-19 mutants show hypersensitivity to 1 mM quinine (44–65% avoidance vs. 18% in wild type) .

    • Rescue requires INX-19 expression in both ASH (nociceptive) and ASK (modulatory) neurons .

  • Synaptic Localization:

    • INX-19 forms punctate structures at neuronal junctions, dependent on INX-18 for proper localization .

Interactions with Other Innexins

INX-19 collaborates with INX-18 in electrical synapses:

InteractionFunctional Outcome
INX-19 + INX-18Double mutants show additive quinine hypersensitivity (53% avoidance)
Localization DependencyINX-19 puncta in ASK neurons decrease in inx-18 mutants
Distinct RolesINX-18 acts in ASK alone, while INX-19 requires both ASK and ASH

Research Tools and Applications

Recombinant INX-19 is used to study gap junction dynamics and neuronal circuits:

  • Expression Systems: Commercial services offer custom synthesis in E. coli (starting at $99 + $0.30/amino acid) .

  • Experimental Techniques:

    • GFP-tagged INX-19 reveals subcellular localization in COS cells and C. elegans .

    • Electrophysiology in Xenopus oocytes confirms channel functionality .

Pathological and Evolutionary Insights

  • Mutation Impact:

    • inx-19(tm1896) (in-frame deletion) disrupts intracellular loop and transmembrane domains, impairing synaptic function .

    • inx-19(ky634) (E>K substitution) alters extracellular loop gating .

  • Conservation: Retained in C. briggsae and C. remanei, underscoring evolutionary importance .

Future Directions

  • Channel Permeability: Structural studies to compare pore size with connexins .

  • Therapeutic Potential: Insights into calcium signaling defects in neurological disorders.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please specify them in your order notes, and we will do our best to accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
inx-19; CBG03987; Innexin-19
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-439
Protein Length
full length protein
Species
Caenorhabditis briggsae
Target Names
inx-19
Target Protein Sequence
MFFHATLARSFISALSVRGDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPH SRESMEEYIESYCWIQNTYWIPMYENVPDDHTAREEKQIGYYQWVPFILIAEALMFSLPC IFWRLCSFQSGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRIRAR GWIARIKFSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLKSSEFVFFGFQVLSDIW AGRPWTETGHFPRVTLCDFEVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIIT TCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLD SFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEYRERNWREFEEHEEMKDVEMRRI QGTRERIVIANPGQTKSFL
Uniprot No.

Target Background

Function
Innexin-19 (inx-19) is a structural component of gap junctions. It plays a crucial role in coordinating left-right asymmetry during the development of the nervous system. Innexin-19 forms gap junction networks that connect embryonic neurons, facilitating electrical coupling between cells and influencing AWC signaling, either promoting or inhibiting it.
Database Links

STRING: 6238.CBG03987

Protein Families
Pannexin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is Innexin-19 and how does it compare structurally to other innexins?

Innexin-19 (INX-19) is one of the gap junction proteins in C. elegans that enables direct cell-to-cell communication. Like other innexins, INX-19 has no primary sequence homology with vertebrate connexins but shares structural and functional similarities . To characterize INX-19's structure, researchers can follow approaches similar to those used for INX-6, which revealed hexagonal gap junction plaques with a channel diameter of approximately 140 Å (compared to connexin26's 92 Å) . For structural analysis, purification of recombinant INX-19 followed by electron microscopy can reveal its quaternary arrangement, while transmembrane domain prediction can be conducted using tools like TOPCONS, with topology visualization via Protter and three-dimensional modeling using RaptorX .

In which tissues is INX-19 expressed and what are its major functions?

INX-19 is primarily expressed in embryonic neurons where it forms functional gap junctions. Researchers have demonstrated this by loading isolated embryonic neurons with photoactivatable fluorescent dyes, which after uncaging by UV light, traveled to neighboring cells through INX-19-formed gap junctions . To map comprehensive expression patterns, researchers should employ techniques including:

  • Fluorescent reporter constructs (INX-19::GFP)

  • In situ hybridization to detect mRNA localization

  • Immunohistochemistry with anti-INX-19 antibodies

  • Single-cell RNA sequencing of C. elegans tissues

What are the key regulatory elements controlling inx-19 expression?

Innexin gene expression in C. elegans often shows dynamic patterns during development. To identify regulatory elements controlling inx-19 expression:

  • Analyze the promoter region (2-3kb upstream of the start codon)

  • Create reporter constructs with progressive deletions to identify minimal promoter elements

  • Perform chromatin immunoprecipitation (ChIP) to identify transcription factor binding sites

  • Use bioinformatics tools to identify conserved regulatory motifs shared with other innexin genes

What are the most effective protocols for producing recombinant INX-19?

Based on research with other innexins, the following methodological approach is recommended for recombinant INX-19 production:

  • Expression System Selection: While INX-6 formed gap junctions in insect Sf9 cells but not in mammalian HeLa cells , researchers should test multiple expression systems for INX-19, including:

    • Baculovirus-infected insect cells (Sf9, High Five)

    • Mammalian cell lines (HEK293, CHO)

    • Bacterial systems with fusion tags to enhance solubility

  • Purification Strategy:

    • Solubilize with mild detergents (digitonin, DDM, or CHAPS)

    • Employ affinity chromatography with polyhistidine or GST tags

    • Further purify via size-exclusion chromatography

  • Quality Control:

    • Verify oligomeric state via native PAGE and crosslinking

    • Assess protein folding through circular dichroism spectroscopy

    • Confirm functionality in reconstituted liposomes

How can dye transfer assays be optimized for studying INX-19 gap junctions?

Dye transfer assays have been successfully used to study innexin-formed gap junctions in C. elegans. For INX-19 specifically:

  • Dye Selection: Use photoactivatable (caged) fluorescent dyes as demonstrated with INX-19 in embryonic neurons . Alternative dyes include:

    • Carboxyfluorescein (MW 376) - successfully used in pharyngeal muscles

    • Lucifer Yellow (MW 457) - effective in intestinal cells

    • Larger dyes (3-10 kDa) to test size exclusion limits, as INX-6 shows permeability to larger molecules than connexins

  • Cell Culture Setup:

    • Establish co-cultures of INX-19 expressing cells with control cells

    • For neuronal studies, isolate embryonic neurons and culture them in clusters

  • Measurement Protocol:

    • Inject or load dye into single cells

    • Monitor spread using time-lapse confocal microscopy

    • Quantify dye transfer rates and distance using image analysis software

What immunohistochemical approaches are most effective for localizing INX-19?

Based on successful immunostaining techniques for other innexins, the following protocol is recommended for INX-19:

  • Fixation and Permeabilization:

    • Fix tissues in 3.7% formaldehyde for 15 minutes

    • Wash with PBSA buffer (140 mM NaCl, 2.7 mM KCl, 1.5 mM KH₂PO₄, 6.5 mM Na₂HPO₄)

    • Permeabilize with 1% Triton X-100 for 10 minutes

  • Antibody Application:

    • Use primary antibody against INX-19 (1:100 dilution)

    • Incubate at room temperature for 12 hours

    • Apply FITC-conjugated secondary antibody (1:200) for 2 hours

    • Counterstain with RNase (10 mg/ml) for 1 hour

  • Imaging:

    • Mount slides with propidium iodide and Vecta Shield

    • Image using laser scanning confocal microscopy

    • Analyze with LSM Image Browser or similar software

How do INX-19 gap junctions contribute to neural circuit function?

Gap junctions formed by innexins like INX-19 in the C. elegans nervous system serve complementary rather than redundant roles with chemical synapses . To investigate INX-19's contribution to neural circuit function:

  • Electrophysiological Approaches:

    • Patch-clamp recordings of coupled neurons

    • Measure electrical coupling coefficients

    • Assess changes in circuit dynamics after selective INX-19 disruption

  • Behavioral Assays:

    • Perform quantitative behavioral tests in wild-type vs. inx-19 mutants

    • Analyze aggregation, foraging, and oxygen/pheromone responses

    • Use optogenetic stimulation combined with calcium imaging to map signal propagation

  • Circuit Mapping:

    • Employ electron microscopy to identify INX-19-containing gap junctions

    • Use GRASP (GFP Reconstitution Across Synaptic Partners) adapted for gap junctions

    • Implement ConnectID or similar techniques to label specific gap junction-connected neurons

What strategies can be used to selectively inhibit INX-19 gap junctions in vivo?

Based on approaches used for other innexins, the following methods can be adapted for INX-19:

  • Genetic Approaches:

    • Generate conditional knockout using tissue-specific promoters

    • Employ cell-specific RNAi against inx-19

    • Develop dominant-negative INX-19 mutants

  • Pharmacological Methods:

    • Test established gap junction blockers (note that carbenoxolone and probenecid showed no effect on UNC-9 )

    • Screen for INX-19-specific inhibitors using high-throughput approaches

    • Develop peptide inhibitors targeting extracellular loops

  • Innovative Approaches:

    • Use the dominant-negative UNC-1(n494) stomatin, which antagonizes UNC-9 gap junctions and may also affect INX-19

    • Develop optogenetic tools to acutely modulate gap junction conductance

    • Design CRISPR interference systems for rapid, reversible suppression

How do mutations in INX-19 affect channel properties and cellular communication?

To characterize how mutations affect INX-19 function:

  • Structure-Function Analysis:

    • Generate point mutations in conserved domains

    • Focus on the C-terminus, as mutations in this region of INX-6 showed strong phenotypes despite being in non-conserved areas

    • Assess effects on trafficking, assembly, and channel function

  • Electrophysiological Characterization:

    • Measure conductance and voltage-gating properties

    • Determine ion selectivity and permeability

    • Assess effects of cytoplasmic pH and calcium on channel function

  • Molecular Dynamics:

    • Perform computational simulations to predict structural changes

    • Model pore size and selectivity filter alterations

    • Identify key residues for channel gating

How does INX-19 compare functionally to other C. elegans innexins?

Innexins in C. elegans demonstrate diverse tissue expression and functional roles. The table below compares key properties of INX-19 with other well-characterized innexins:

InnexinPrimary ExpressionKnown FunctionsPermeabilityKnockout Phenotype
INX-19Embryonic neuronsNeuronal communicationAllows passage of caged fluorescent dyesNot fully characterized
INX-6Pharyngeal musclesSynchronized muscle contractionsPermeable to 3-10 kDa tracersCold-sensitive, developmental arrest
UNC-9Various tissuesAggregation behavior, locomotionAllows carboxyfluorescein transferStrong locomotion defect
INX-14/22Gonadal sheath cellsGerm cell communication, pathogen resistanceNot characterizedResistance to S. aureus
INX-8/9Reproductive tissuesSperm guidanceNot characterizedSperm guidance defects

For comprehensive characterization of INX-19 relative to other innexins:

  • Generate comparative expression maps using reporter constructs

  • Perform rescue experiments to test functional redundancy

  • Create chimeric proteins to identify domain-specific functions

  • Test for heteromeric channel formation between INX-19 and other innexins

Can INX-19 form heteromeric channels with other innexins?

Many gap junction proteins can form heteromeric channels with different properties than homomeric channels. To investigate this possibility for INX-19:

  • Co-expression Studies:

    • Co-express INX-19 with other innexins in heterologous systems

    • Use differentially tagged innexins (GFP, RFP) to visualize co-localization

    • Perform co-immunoprecipitation to detect physical interactions

  • Functional Characterization:

    • Compare dye transfer properties of homo- vs. heteromeric channels

    • Measure electrophysiological properties of mixed channels

    • Assess changes in regulation and gating

  • In vivo Analysis:

    • Generate double mutants of inx-19 and other innexins

    • Look for synergistic or compensatory effects

    • Use proximity ligation assays to detect interacting innexins in native tissues

What are the potential applications of recombinant INX-19 in neurobiology research?

Recombinant INX-19 offers several research applications:

  • Bioengineering Applications:

    • Creation of synthetic neural networks with defined electrical coupling

    • Development of biosensors based on gap junction permeability

    • Design of drug delivery systems targeting specific cell populations via gap junctions

  • Fundamental Research:

    • Investigating the evolutionary relationship between innexins and connexins

    • Understanding principles of electrical synapse formation and regulation

    • Exploring the role of gap junctions in neural development and plasticity

  • Methodological Advances:

    • Using INX-19 channels as conduits for delivering genetic material between cells

    • Developing high-throughput screens for gap junction modulators

    • Creating tools for mapping functional connectivity in neural circuits

What are the most promising directions for future INX-19 research?

Based on current knowledge gaps, the following research directions offer significant potential:

  • Structural Biology:

    • Determination of high-resolution crystal or cryo-EM structures of INX-19

    • Mapping the binding sites of regulatory proteins

    • Identifying the molecular basis of selective permeability

  • Systems Neuroscience:

    • Defining the contribution of INX-19 gap junctions to neural circuit function

    • Investigating how electrical synapses complement chemical transmission

    • Understanding the role of INX-19 in neurodevelopmental processes

  • Translational Research:

    • Exploring innexin function in disease models

    • Developing therapeutic strategies targeting gap junction communication

    • Investigating the potential for INX-19-based neural interfaces

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.