Recombinant Innexin-5 (inx-5)

Shipped with Ice Packs
In Stock

Description

Introduction to the Innexin Family

Innexins represent a highly conserved protein family that forms the structural components of gap junctions in invertebrates. Gap junctions are specialized intercellular connections that allow direct communication between adjacent cells through the exchange of ions, metabolites, and small signaling molecules. In C. elegans, 25 innexin genes have been identified, highlighting the complexity and importance of gap junction-mediated communication in these organisms .

Unlike vertebrates that utilize connexins for gap junction formation, invertebrates employ innexins for similar cellular functions. The extensive conservation of innexin genes across Caenorhabditis species suggests their fundamental importance in organismal development and function. Genome analyses of C. elegans, C. briggsae, and C. remanei reveal that each species has retained at least one ortholog of each innexin type, strongly indicating that these genes have essential, non-redundant functions .

Genomic Organization

The genomic organization of innexins provides insight into their evolutionary relationships and potential functional associations. In C. elegans, several innexins, including inx-12 and others, are arranged in polycistronic clusters . While inx-5 is not explicitly described as being part of such a cluster in the available search results, understanding its genomic context would provide valuable information about its regulation and relationship to other innexin family members.

Expression Patterns of Innexin-5

High-resolution expression mapping studies have revealed the specific cellular distribution of innexins in C. elegans. These studies utilized in vivo homologous recombination to generate promoter-GFP transcriptional fusions, allowing for comprehensive visualization of innexin expression patterns .

Expression in the Alimentary System

Innexin-5 demonstrates a distinctive expression pattern within the alimentary system of C. elegans. It is strongly and consistently expressed in both the anterior and posterior arcades of the buccal cavity . These structures represent transitional epithelia at the anterior end of the alimentary system, facilitating the initial stages of feeding.

Cell-Specific Expression

Within the alimentary system, inx-5 appears to be expressed at higher levels in the B epithelial cell compared to other cells . This differential expression suggests cell-specific functions for inx-5, potentially related to specialized intercellular communication requirements in these cells.

Comparative Expression in Alimentary Structures

The table below summarizes the expression patterns of various innexins, including inx-5, in different structures of the alimentary system:

Alimentary StructureStrong and Consistent ExpressionWeak or Rare Expression
Anterior arcadesinx-5, inx-9, inx-11inx-3, inx-12
Posterior arcadesinx-5, inx-9, inx-11inx-3, inx-12, unc-7a, unc-9
Pharyngeal epitheliuminx-3, inx-6, inx-10, inx-11inx-7, inx-8, inx-20
pm1 (pharyngeal muscle)inx-1, inx-6, inx-8, inx-10, inx-20inx-11, inx-7
pm2inx-6, inx-10, inx-20, eat-5inx-3, inx-7, inx-8, inx-9, inx-11

This expression pattern comparison demonstrates that inx-5's distribution is primarily focused in the anterior alimentary structures, while other innexins are more broadly distributed throughout the pharyngeal muscles and epithelia .

Functional Implications of Innexin-5 Expression

The distinctive expression pattern of innexin-5 suggests specific functional roles, particularly in intercellular communication within the anterior alimentary system of C. elegans.

Potential Role in Feeding Behavior

The strong expression of inx-5 in the anterior and posterior arcades of the buccal cavity suggests a potential role in coordinating feeding behaviors. Gap junctions in these regions may facilitate synchronized contractions of the buccal cavity during the intake of food.

Comparison with Other Innexins

Studies on other innexins provide context for understanding potential inx-5 functions. For example, inx-6 has been shown to play a crucial role in coupling muscle cells of the anterior pharynx, with mutations causing defects in pharyngeal pumping and subsequent developmental arrest . Given inx-5's expression in adjacent structures, it may have complementary functions in coordinating feeding movements.

Similarly, eat-5, another innexin family member, is essential for electrical coupling between pharyngeal muscles. Mutations in eat-5 uncouple the muscles of the terminal bulb from those of the metacorpus, resulting in asynchronous contractions between the anterior and posterior pharynx . The overlapping expression domains of multiple innexins in the alimentary system suggest complex coordination of gap junction-mediated communication.

Recombinant Production of Innexins

While the search results do not specifically address recombinant production of innexin-5, general principles of recombinant protein production can be applied to understand potential approaches for generating recombinant innexin-5.

Expression Systems

Recombinant innexins, including inx-5, could potentially be produced in various expression systems including bacterial (E. coli), yeast (S. cerevisiae, P. pastoris), insect cell (Sf9, High Five), or mammalian cell systems. Each system offers distinct advantages in terms of protein folding, post-translational modifications, and yield.

Purification Strategies

Purification of recombinant innexins would likely involve affinity chromatography utilizing fusion tags (His-tag, GST, MBP) followed by additional purification steps such as ion exchange chromatography or size exclusion chromatography to achieve high purity. The membrane protein nature of innexins presents challenges for maintaining proper folding and function during purification.

Functional Characterization

Functional characterization of recombinant innexin-5 would be essential to confirm its gap junction-forming capabilities. This could involve reconstitution into liposomes or planar lipid bilayers to measure channel conductance, dye transfer assays to assess permeability, or cell-based assays to evaluate intercellular communication functionality.

Research Applications of Recombinant Innexin-5

Recombinant innexin-5 could serve various research applications in understanding gap junction biology in invertebrates.

Interaction Studies

Recombinant innexin-5 could be utilized in interaction studies to identify binding partners and regulatory molecules. Techniques such as pull-down assays, surface plasmon resonance, or yeast two-hybrid screens could reveal proteins that interact with innexin-5 to regulate gap junction assembly, function, or degradation.

Functional Reconstitution

Functional reconstitution of recombinant innexin-5 into artificial membrane systems would allow detailed biophysical characterization of channel properties, including conductance, selectivity, and gating mechanisms. Such studies would contribute to our understanding of how innexin-based gap junctions facilitate intercellular communication.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
inx-5; opu-5; R09F10.4; Innexin-5; Protein opu-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-447
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
inx-5
Target Protein Sequence
MIGVLLPYVRKFQRSAESNDIADRFSYQYTSTLLGFSAIMMAASQYVGRPIQCWVPAQFT RTWEKYAETYCFIKGTYFLPGAFASEGEMSVTSPDDAVTATPQVGYYQWIPIVLVLQAFL FYLPSIIWRTFNESCELKIKELAAVSEASRKIKSNMSDDQVKATKFGRYFFKKLNFRNES PVFKETGSVVASGKFLPALYLLVKILYLANIVLQFWILTYFLETKSWMWGWQTFQDLMAG REWETTGIFPRVTMCDFSIMDLTSVHDHSIQCVIVINMLAEKVYVFFWFWLLFVGLLTVC SLAYWAVIYMLQSVGRNFIYSYLQQTPEFQTEQERGSFVPANFVDKCLTPDGVFISRLVQ QNSGDLFTSIMLGEMFSLYRAREAEKAHKKDDDSALPASAPVDLQEDDDDDTPFPPPTKA VAETLTSDDEEEETDVDSPDTTATLPR
Uniprot No.

Target Background

Function
Structural component of the gap junctions.
Database Links

KEGG: cel:CELE_R09F10.4

STRING: 6239.R09F10.4

UniGene: Cel.6410

Protein Families
Pannexin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What are innexins and how do they function in cellular communication?

Innexins represent a highly conserved protein family that forms the structural components of gap junctions in invertebrates. These transmembrane proteins create channels between adjacent cells, allowing for electrical coupling and small molecule exchange. In Caenorhabditis elegans, innexins play crucial roles in coordinating muscle contractions, particularly in the pharynx where they facilitate synchronous muscle movement necessary for feeding . The punctate expression pattern of innexins at the plasma membrane is characteristic of gap junction proteins, appearing as distinct plaques where cell-cell connections occur .

How does innexin-5 relate to other innexin family members in invertebrates?

While specific information about innexin-5 is limited in the available literature, we can understand its position within the innexin family by examining related members. C. elegans possesses multiple innexin genes with distinct expression patterns and functions. For instance, inx-6 is expressed throughout the pharynx at all larval stages, while eat-5 appears specifically in the metacorpus and isthmus muscles . Phylogenetic analysis suggests that different innexins evolved for specialized coupling functions between specific cell types, with some showing functional redundancy or complementation, as demonstrated when EAT-5 partially rescued inx-6 mutant phenotypes .

What experimental systems are most suitable for studying innexin function?

C. elegans represents an excellent model organism for innexin research due to its genetic tractability and transparent body, which facilitates visualization of fluorescently tagged proteins. Temperature-sensitive mutations (such as inx-6(rr5)) provide valuable tools for temporal control of innexin function . Electrophysiological recordings, particularly electropharyngeograms (EPGs), offer quantitative assessment of cellular coupling in vivo . Additionally, single-cell RNA sequencing approaches have been effectively employed to characterize innexin expression patterns across different tissues and developmental stages in various organisms, including ctenophores .

What techniques are available for assessing gap junction functionality in innexin-expressing tissues?

Dye-coupling experiments represent a powerful approach for evaluating gap junction functionality. In this method, fluorescent dyes like carboxyfluorescein are introduced into specific cells, and their diffusion to adjacent cells is monitored. In wild-type C. elegans, carboxyfluorescein introduced into terminal bulb muscles diffuses throughout all pharyngeal muscles within 60 seconds, whereas in inx-6 mutants, the dye fails to reach the procorpus despite spreading to other regions . This technique clearly demonstrates defective gap junction coupling between specific muscle groups.

Electrophysiological recordings provide complementary functional data. The electropharyngeogram (EPG) technique measures electrical activity throughout the pharynx, providing insights into the coordination of muscle contractions and the propagation of electrical signals . Abnormal EPG patterns can reveal coupling defects that may not be apparent through morphological assessment alone.

How can genetic approaches be used to investigate innexin function?

Several genetic approaches are effective for studying innexins:

  • Mutant analysis: Temperature-sensitive mutations like inx-6(rr5) allow researchers to control innexin function temporally, facilitating the study of developmental requirements while avoiding embryonic lethality .

  • RNAi knockdown: RNA interference provides an alternative method for reducing innexin expression, often generating phenotypes similar to genetic mutations .

  • Rescue experiments: Wild-type innexin genes can be reintroduced into mutant backgrounds to confirm gene identity and assess functional requirements. Frame-shifted constructs serve as negative controls, as demonstrated with Δinx-6 that failed to rescue the inx-6(rr5) phenotype .

  • Gene substitution: Expressing one innexin under the control of another innexin's promoter helps determine functional redundancy. For example, EAT-5 expression under the inx-6 promoter partially rescued inx-6(rr5) mutants, suggesting similar but not identical functions .

  • Fluorescent protein fusions: INX-6::GFP fusion constructs revealed the subcellular localization of innexins to membrane plaques characteristic of gap junctions .

What methods are effective for analyzing innexin expression patterns?

Expression analysis approaches include:

  • Reporter gene fusions: Promoter regions driving fluorescent proteins help visualize tissue-specific expression patterns .

  • Single-embryo RNA-Seq: This technique tracks innexin expression throughout development, revealing temporal coordination between different family members .

  • Single-cell RNA-Seq: This approach identifies cell-type specific expression and co-expression patterns. In ctenophores, this method revealed that INXB and INXD were comarkers in digestive, smooth muscle, and epithelial cells, while other innexins showed distinct expression in neural or comb plate cells .

How do mutations in innexin genes affect electrical coupling and organism physiology?

Mutations in innexin genes can produce specific defects in electrical coupling with profound physiological consequences. In C. elegans, inx-6(rr5) mutations at restrictive temperature reduce electrical coupling specifically between the procorpus and metacorpus muscles of the pharynx, causing premature relaxation of the anterior pharynx that interferes with feeding . This coupling defect prevents larvae from initiating post-embryonic development despite continuing to pump at rates higher than eat-2 mutants (see Table 1).

Table 1. Comparison of pharyngeal pumping rates in wild-type and mutant C. elegans

GenotypePumping rate (contractions/min) at 15°CPumping rate (contractions/min) at 25°C
-5HT+5HT
N2 (wild-type)134.4 ± 11.2149.3 ± 16.6
inx-6(rr5)131.9 ± 12.1141.2 ± 15.1
eat-2(ad465)17.9 ± 4.616.9 ± 4.6

Values represent contractions/minute ± standard deviation observed from 20 animals. 5HT indicates the presence or absence of 5mM serotonin .

Similarly, eat-5 mutations specifically uncouple the terminal bulb from the metacorpus, causing asynchronous contractions between anterior and posterior pharyngeal regions while maintaining synchrony within each region . These observations demonstrate that different innexins control electrical coupling between specific muscle groups, with mutations producing distinct physiological defects.

What is known about the pharmacokinetic properties of recombinant innexins?

While specific pharmacokinetic data on recombinant innexin-5 is not available in the provided sources, insights can be drawn from studies of other recombinant proteins. For instance, recombinant human annexin A5 (SY-005, a different protein family) showed dose-dependent plasma concentrations following intravenous administration, with a relatively short half-life of approximately 0.9 hours and rapid clearance . This information suggests that recombinant proteins administered therapeutically require careful dosing regimens to maintain effective concentrations.

For recombinant innexins, similar pharmacokinetic considerations would apply, including monitoring plasma concentrations, determining clearance rates, and assessing potential accumulation with repeated dosing. Researchers working with recombinant innexin-5 should establish detailed pharmacokinetic profiles to inform experimental design, particularly for in vivo applications.

How can bioinformatic approaches contribute to innexin research?

Bioinformatic methods provide valuable tools for innexin characterization:

  • Domain identification: The Innexin PFAM domain (PF00876) serves as a reference for identifying putative innexins in genomic data .

  • Sequence alignment: Tools like MAFFT enable comparative analysis of innexin sequences across species, revealing conserved regions that may be functionally important .

  • Phylogenetic analysis: Multiple approaches (IQ-TREE, RAxML, MrBayes) can generate evolutionary trees to understand innexin relationships and potential functional convergence or divergence .

  • Expression pattern analysis: Computational processing of RNA-Seq data, including clustering approaches for single-cell data, helps identify cell types expressing specific innexins and potential co-expression patterns .

These approaches not only inform our understanding of innexin evolution but also provide practical insights for experimental design, such as identifying conserved regions for antibody development or engineering recombinant proteins with enhanced stability or function.

To what extent can different innexins functionally substitute for each other?

This partial rescue suggests that while EAT-5 and INX-6 share sufficient functional properties to form gap junctions in the appropriate tissues, they likely have distinct biophysical properties that affect channel conductance, selectivity, or regulation. Researchers investigating innexin-5 should consider the possibility of both unique functions and partial redundancy with other family members when designing experiments and interpreting results.

How do expression patterns inform our understanding of innexin function?

Expression pattern analysis reveals important insights about innexin function:

  • Tissue specificity: Different innexins show distinct tissue expression patterns, suggesting specialized roles. For example, eat-5 expression is limited to metacorpus and isthmus muscles, while inx-6 shows broader pharyngeal expression .

  • Developmental regulation: Some innexins show coordinated expression throughout development, as observed for INXB and INXD in ctenophores, suggesting functional cooperation .

  • Cell-type specificity: Single-cell RNA-Seq analysis in ctenophores revealed specific innexin expression in neural cells (INXO, INXG1) versus comb plate cells (INXH, INXL), indicating specialized roles in different cell types .

  • Co-expression patterns: Identification of innexins consistently co-expressed in the same cells provides evidence for potential heteromeric channel formation or coordinated regulation .

These expression patterns guide functional studies by identifying where and when specific innexins are likely to play important roles, helping researchers focus experimental efforts on relevant tissues, developmental stages, and potential functional interactions.

What emerging technologies might advance innexin research?

Several emerging technologies hold promise for advancing innexin research:

  • CRISPR-Cas9 gene editing: This approach enables precise genetic manipulation, including knockout, knockin, and tagging of endogenous innexin genes with minimal off-target effects.

  • Cryo-electron microscopy: This technique could reveal the molecular structure of innexin-based gap junctions, providing insights into channel properties and regulation.

  • Optogenetics: Light-controlled manipulation of cells expressing specific innexins could enable temporal control of gap junction activity in defined cell populations.

  • Single-molecule imaging: Super-resolution microscopy techniques could track the dynamics of innexin trafficking, assembly, and turnover in living cells.

  • Transcriptomics and proteomics: These approaches could identify genes and proteins that interact with innexins or regulate their function under different conditions.

Researchers studying innexin-5 should consider incorporating these advanced techniques to gain novel insights into its structure, function, and regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.