Recombinant Innexin-7 (inx-7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
inx-7; opu-7; K02B2.4; Innexin-7; Protein opu-7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-556
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
inx-7
Target Protein Sequence
MFVFRVLNTVPYTNRTGAKDLVASIHSFLTSNLLVGLAVLISWKQFGGTPIECMVPLDFT SAWVQYSNNYCWAQPTYFIPFTEELVEQVVDPADVVADGITIGNGGNRPRFVKKGGEKIS YYQWMSFFLLFEAACFRLPCFIWKYFASQSGMQVGEILRVASDENNAVPLVKKANIDALC IHLRGVLRFQKRLKLKKIVPHKILRFLNIKYSAYYVTFIYFVAKVAFLLNVILQSKLLNK YMLPHDRQQNFGFDMWKTIFYGSTNGNETWRENGVFPRVTLCDFETRDMGNVQMHTVQCV LLLNLFTEKIFVFLWAWYILLTAFTVGNLFSWLFAVFNETYNEHFILNHLEMCETPFDKD DLKNREHVTRFITLYLGTDGLFLLQLIAQHADVVFTTELIAALFKTYIEIEAQRATLKQM NAVLPLLRPNDESQVESGKNTAPSTSHNVRRRGTEQLEKNVKSRQGSLSTQLRPFNSFEE PDQPTKKFDDSSSEDENSKKGSKKPSPTKKKASSKNSPQSSSNSRRPSLAHTASPAFTHH HEPDSKIPKTAEKKHW
Uniprot No.

Target Background

Function
Innexin-7 (inx-7) is a structural component of gap junctions.
Database Links

KEGG: cel:CELE_K02B2.4

STRING: 6239.K02B2.4

UniGene: Cel.12707

Protein Families
Pannexin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is Innexin-7 and how is it expressed during development?

Innexin-7 belongs to the innexin family of gap junction proteins, which form channels between adjacent cells allowing for direct cell-to-cell communication. In Drosophila, Innexin-7 protein is expressed in all embryonic epithelia from early to late stages of development, including the developing epidermis and gastrointestinal tract . The expression pattern changes during development: in early embryonic stages, Innexin-7 localizes to the nucleus, while in later stages it adopts a punctate pattern in the cytoplasm and at the membrane of most epithelial tissues . During central nervous system (CNS) development, Innexin-7 is expressed in cells of the neuroectoderm and mesectoderm, and later becomes restricted to a segmental pattern in specific glial and neuronal cells derived from midline precursors .

How does Innexin-7 contribute to neuronal synchronization?

Innexin-7 plays a significant role in coordinating synchronized activity between projection neurons (PNs) in the Drosophila antennal lobe (AL). In cultured PNs, spontaneous calcium transients show high synchronization when neurons are physically connected, and this synchronization is blocked when Innexin-7 is knocked down via RNAi . This synchronization is independent of fast chemical neurotransmission, suggesting that electrical synapses formed by Innexin-7 are responsible for the coordinated activity . In vivo, downregulation of Innexin-7 in the AL impairs both vinegar-induced electrophysiological calcium responses and behavioral responses to this appetitive stimulus .

How can recombinant Innexin-7 protein be generated?

To generate recombinant Innexin-7 protein, researchers typically follow a protocol similar to that used for other innexins. Based on methods described for Innexin-2, the process involves:

  • Cloning: Amplify the desired region of the Innexin-7 gene (often the first extracellular loop, which contains immunogenic epitopes) by PCR and clone it into an appropriate bacterial expression vector like pET28a with appropriate restriction sites (e.g., NotI and SalI) .

  • Expression: Transform the plasmid into an E. coli expression strain (typically BL21(DE3)), and induce protein expression with IPTG .

  • Purification: Purify the soluble protein using affinity chromatography, such as Ni-NTA agarose for His-tagged proteins .

  • Verification: Confirm protein identity and purity using SDS-PAGE, which should show a single band of the expected molecular weight .

For functional studies, full-length Innexin-7 can be amplified from cDNA and subcloned into appropriate expression vectors with or without fusion tags depending on the experimental needs .

What are the optimal methods for generating antibodies against Innexin-7?

Based on the methodology used for innexin antibody generation, the following approach is recommended for Innexin-7 antibodies:

  • Antigen selection: The first extracellular loop is often targeted as it is accessible and immunogenic. For Innexin-7, this would correspond to a region similar to amino acids 48-134 as described for Innexin-2 .

  • Recombinant protein production: Express and purify the selected region as described in section 2.1.

  • Immunization: Use the purified recombinant protein to immunize rabbits for polyclonal antibody production .

  • Antibody purification: Purify the resulting polyclonal antibody using protein A-Sepharose affinity chromatography .

  • Validation: Verify antibody specificity using Western blotting against the recombinant protein and tissue samples from wild-type and Innexin-7 knockdown animals.

How can RNAi be effectively used to knock down Innexin-7 expression?

RNAi-mediated knockdown of Innexin-7 has been successfully employed in both cell culture and in vivo models. The approach involves:

  • RNAi construct design: Design RNAi constructs targeting specific regions of the Innexin-7 mRNA. Effective RNAi strains for Drosophila Innexin-7 include those available from stock centers (e.g., VDRC strain ID#22949) .

  • Delivery system: For Drosophila studies, use the GAL4-UAS system to drive expression of the RNAi construct in specific tissues. The GH146-GAL4 driver is effective for targeting antennal lobe projection neurons .

  • Expression control: Maintain flies at lower temperatures (e.g., 18°C) during development to minimize GAL4-driven gene expression, then shift to room temperature (22°C) several days before experiments to allow for RNAi expression .

  • Validation: Confirm knockdown efficiency using qPCR. An effective RNAi strain should reduce Innexin-7 mRNA levels by at least 80% compared to controls. For example, the VDRC strain ID#22949 achieved an 85±7% decrease in Innexin-7 mRNA expression .

  • Control selection: Use appropriate genetic controls, including parental strains and strains expressing non-targeting RNAi constructs .

What methods are used to visualize Innexin-7 expression and localization?

To visualize Innexin-7 expression and localization in tissues, immunofluorescence staining is commonly used:

  • Sample preparation: Relax specimens with an appropriate agent (e.g., 2% urethane for Hydra), fix with paraformaldehyde (typically 2%), and permeabilize with a detergent such as Triton X-100 .

  • Blocking: Block non-specific binding with BSA (1%) in PBS containing a low concentration of detergent (0.1% Triton X-100) .

  • Primary antibody: Incubate with the anti-Innexin-7 antibody at an appropriate dilution (typically 1:200) in blocking solution .

  • Secondary antibody: Use fluorescently labeled secondary antibodies (e.g., Alexa488-coupled anti-rabbit) for detection .

  • Co-staining: For co-localization studies, combine with other antibodies (e.g., anti-Tyrosine-Tubulin) and use differently labeled secondary antibodies .

  • Imaging: Acquire images using confocal laser-scanning microscopy for optimal resolution of subcellular localization .

How can the role of Innexin-7 in synchronized neuronal activity be assessed?

To assess the role of Innexin-7 in synchronized neuronal activity, researchers can employ several complementary approaches:

  • Calcium imaging in cell culture:

    • Isolate neurons from appropriate areas (e.g., antennal lobe PNs from Drosophila)

    • Culture neurons to allow formation of physical connections

    • Load cells with calcium indicators (e.g., Fluo-4)

    • Record spontaneous calcium transients in connected neuron pairs

    • Compare synchronization in control vs. Innexin-7 knockdown conditions

  • Electrophysiological recordings:

    • Perform patch-clamp recordings from connected neuron pairs

    • Measure electrical coupling coefficients

    • Test the effect of gap junction blockers (e.g., heptanol at 0.06%)

    • Compare coupling in control vs. Innexin-7 knockdown conditions

  • In vivo calcium imaging:

    • Express genetically encoded calcium indicators in specific neuronal populations

    • Record calcium responses to relevant stimuli (e.g., vinegar for olfactory neurons)

    • Compare response patterns between control and Innexin-7 knockdown animals

  • Behavioral assays:

    • Design assays that depend on synchronized neuronal activity (e.g., olfactory responses)

    • Compare behavioral performance between control and Innexin-7 knockdown animals

What methods are used to analyze co-expression of Innexin-7 with other innexins?

Co-expression analysis of innexins is critical for understanding potential heteromeric or heterotypic gap junction formation. Several approaches can be used:

  • Single-cell RNA-Seq analysis:

    • Generate single-cell transcriptome data from tissues of interest

    • Calculate the percentage of cells expressing each innexin

    • Identify pairs of innexins with significant co-expression patterns

    • Quantify the percentage of cells expressing one innexin that also express another

  • Tissue-specific RNA-Seq:

    • Isolate RNA from specific tissues or regions (e.g., tentacle bulbs, comb rows, aboral organs)

    • Compare relative expression levels of different innexins across tissues

    • Identify innexins with similar expression patterns across multiple tissues

  • Immunofluorescence co-localization:

    • Perform double-immunostaining with antibodies against different innexins

    • Analyze co-localization at the subcellular level using confocal microscopy

    • Quantify Pearson's correlation coefficients or other co-localization metrics

  • Co-immunoprecipitation:

    • Use antibodies against one innexin to immunoprecipitate protein complexes

    • Detect co-precipitated innexins by Western blotting

    • Confirm direct protein-protein interactions between different innexins

How do innexin expression patterns compare across different species?

SpeciesInnexin Family SizeExpression PatternKey Features
Drosophila8 membersComplex and overlapping expression in developmentInnexin-7 expressed in epithelia, CNS, midline glia, pioneer neurons
HydraSmall subsetInnexin-2 expressed in nerve cells in lower body columnForms gap junctions that coordinate spontaneous body contractions
M. leidyi (ctenophore)Multiple members (INXA-P)Wide expression, with 63% of cells expressing at least one innexinINXB and INXD highly expressed in most cells; 34% of cells express at least two innexins

Analysis of innexin co-expression in M. leidyi revealed several significant pairings:

  • INXB-INXC, INXB-INXG2, INXB-INXP, INXB-INXJ

  • INXD-INXJ, INXD-INXC

  • INXG1-INXG2, INXH-INXA, INXH-INXL, INXH-INXM

These patterns suggest that certain innexins may form heteromeric or heterotypic gap junctions in specific tissues or developmental contexts.

What are the key experimental controls for Innexin-7 functional studies?

Proper experimental controls are essential for reliable interpretation of Innexin-7 functional studies:

  • RNAi knockdown controls:

    • Parental strains without RNAi construct

    • Strains expressing non-targeting RNAi constructs

    • Multiple independent RNAi lines targeting different regions of Innexin-7

    • qPCR validation of knockdown efficiency

  • Calcium imaging controls:

    • Gap junction blockers (e.g., heptanol) to confirm the role of electrical synapses

    • Blockers of chemical synaptic transmission (e.g., PTX) to rule out involvement of chemical synapses

    • Voltage-gated calcium channel blockers (e.g., PLTXII) to confirm calcium signaling mechanism

  • Behavioral assay controls:

    • Multiple genetic backgrounds to control for potential genetic modifiers

    • Different sensory stimuli to assess specificity of defects

    • Rescue experiments with wild-type Innexin-7 expression

  • Expression analysis controls:

    • Multiple housekeeping genes for qPCR normalization (e.g., RP49)

    • In situ hybridization to confirm immunostaining specificity

    • Developmental time series to track dynamic expression changes

How does the molecular structure of Innexin-7 relate to its function?

While the detailed molecular structure of Innexin-7 has not been fully resolved, structure-function relationships can be inferred from conserved features of innexin proteins:

  • Membrane topology: Innexins typically have four transmembrane domains, two extracellular loops, and cytoplasmic N- and C-termini.

  • Functional domains:

    • The first extracellular loop (amino acids ~48-134 by analogy with Innexin-2) likely contains domains involved in docking between adjacent cells

    • The cytoplasmic domains often contain regulatory sites for post-translational modifications

    • The second extracellular loop may contribute to channel properties

  • Oligomerization: Six innexin subunits form a hemichannel (connexon), and two hemichannels from adjacent cells dock to form a complete gap junction channel.

  • Heteromeric and heterotypic channels: Different innexins can combine to form heteromeric hemichannels or heterotypic complete channels, potentially explaining the co-expression patterns observed in single-cell RNA-Seq data .

Future research directions should include structural studies of recombinant Innexin-7 using cryo-electron microscopy and site-directed mutagenesis to identify critical residues for channel function and interaction with other innexins.

What is the relationship between Innexin-7 and other innexin family members?

Innexin-7 is one of eight innexin family members in Drosophila, and its relationship with other family members is complex:

  • Expression overlap: Many innexins show overlapping expression patterns during development, suggesting functional redundancy or cooperation .

  • Functional specificity: Despite overlapping expression, knockdown studies indicate that Innexin-7 has specific functions that cannot be compensated by other family members, particularly in axon guidance and neuronal synchronization .

  • Evolutionary conservation: Comparison across species shows that different innexin family members have been retained and expanded independently in different lineages, suggesting adaptive evolution of gap junction-mediated communication .

  • Co-expression patterns: In ctenophores like M. leidyi, specific pairs of innexins show correlated expression patterns, suggesting they may form heteromeric or heterotypic channels with specialized functions .

Understanding the functional relationships between Innexin-7 and other family members requires comprehensive expression mapping, protein-protein interaction studies, and combinatorial functional analysis using multiple knockdowns.

How do environmental factors and signaling pathways regulate Innexin-7 function?

Regulation of Innexin-7 function likely involves multiple mechanisms:

  • Developmental regulation: Innexin-7 shows dynamic changes in expression and subcellular localization during development, transitioning from nuclear localization in early embryonic stages to membrane localization in later stages . This suggests active regulation of both expression and trafficking.

  • Activity-dependent regulation: Gap junction coupling can be modulated by neuronal activity, possibly through post-translational modifications of innexins.

  • Signaling pathways: While specific pathways regulating Innexin-7 are not fully characterized, studies of other innexins suggest potential regulation by:

    • cAMP/PKA signaling

    • Calcium/calmodulin-dependent kinases

    • Tyrosine kinases and phosphatases

  • Environmental factors: Temperature, pH, and oxidative stress can affect gap junction coupling and may regulate Innexin-7 function in vivo.

Further research using phosphoproteomic analysis, targeted mutagenesis of potential regulatory sites, and in vivo imaging of Innexin-7 dynamics under different physiological conditions would help elucidate the regulatory mechanisms controlling Innexin-7 function.

What are common challenges in working with recombinant Innexin-7?

Researchers working with recombinant Innexin-7 may encounter several challenges:

  • Protein solubility: As a membrane protein with multiple transmembrane domains, full-length Innexin-7 may have solubility issues when expressed in bacterial systems. Using only the extracellular domains for antibody production can improve solubility .

  • Proper folding: Ensuring correct folding of recombinant Innexin-7 may require eukaryotic expression systems that provide appropriate post-translational modifications and chaperones.

  • Functional reconstitution: Demonstrating functionality of recombinant Innexin-7 in artificial systems requires careful design of liposome reconstitution experiments or expression in gap junction-deficient cell lines.

  • Specificity of tools: Antibodies against Innexin-7 must be carefully validated for specificity, particularly given the presence of multiple innexin family members with potential sequence similarities .

  • Physiological relevance: Correlating in vitro findings with recombinant Innexin-7 to its in vivo functions requires complementary approaches, including genetic studies in model organisms .

How can contradictory results in Innexin-7 studies be reconciled?

When facing contradictory results in Innexin-7 research, consider these methodological approaches:

  • Genetic background effects: Different genetic backgrounds can influence Innexin-7 function and phenotypes. Use isogenic controls and multiple independent genetic manipulations to confirm results .

  • Developmental timing: Innexin-7 shows dynamic expression during development . Contradictory results may reflect different developmental stages or temperature-dependent GAL4 expression in Drosophila experiments .

  • Compensation mechanisms: Knockdown versus knockout approaches may yield different results due to compensatory upregulation of other innexins. Acute manipulations using optogenetic or pharmacological approaches may avoid compensation.

  • Tissue specificity: Innexin-7 may have different functions in different tissues. Cell-type specific manipulations with appropriate GAL4 drivers can help resolve tissue-specific functions .

  • Technical considerations: Differences in RNAi efficiency, antibody specificity, or experimental conditions can lead to contradictory results. Standardized protocols and multiple technical approaches can help resolve these issues .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.