Recombinant Innexin-8 (inx-8)

Shipped with Ice Packs
In Stock

Description

Functional Roles in C. elegans

INX-8 is essential for:

  • Germline Proliferation: Partners with INX-9 in somatic gonadal sheath cells to maintain germline stem cells. Double inx-8/9 mutants exhibit severe germline depletion .

  • Metabolite Transport: Facilitates malonyl-CoA transfer from somatic cells to germline, ensuring embryonic viability .

  • Somatic Architecture: Regulates distal positioning of sheath cells (Sh1) relative to the germline. Dominant antimorphic alleles (e.g., inx-8(qy78[mKate2::inx-8]) disrupt this spatial organization, eliminating "bare regions" between Sh1 and the distal tip cell .

Dominant Antimorphic Effects

The mKate2::INX-8 fusion protein mislocalizes Sh1 distally due to compromised channel function, illustrating its role in somatic-germline signaling . Deleting the mKate2 tag (inx-8(tn2034)) restores wild-type Sh1 positioning and brood size .

Genetic Interactions

  • inx-14(ag17) enhances embryonic lethality in inx-8(qy78) mutants .

  • inx-9(ok1502) partially suppresses inx-8(qy78) lethality, highlighting functional redundancy .

Stress Sensitivity

Strains expressing mKate2::INX-8 exhibit growth variability under stress (e.g., starvation), suggesting metabolic dependencies linked to INX-8-mediated transport .

Research Applications

Recombinant INX-8 enables:

  • Gap Junction Studies: Investigating channel assembly and intercellular communication mechanisms .

  • Germline Development Models: Probing somatic-germline signaling pathways and stem cell regulation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary based on purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag whenever feasible.
Synonyms
inx-8; opu-8; ZK792.2; Innexin-8; Protein opu-8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
inx-8
Target Protein Sequence
MFSVPFLTSLTSHLGITAIDDASDTLSCLITAFLFITAAILTSAKTYVGSAMECWLPQTY SGDWGEFAENYCFLKDTYFYPRQQSMTDIPMYHKERHRLTYYQWSSMYLAVAGIAFMIPK FLWRLSQSTTDMPVVYFCDTANEIKNETEDKRSAKIKEMARFMRTKITSVHTPSLFSFIR MYMVYSVIKILYLVNAIAQFVIIAIFLGQKRNLFWGWTLFMNLLNGITWETTGLFPRVTF CDFQVREMAGNNRDETVECVIGINEFNEKIFLFFWFWLVFLVFSTLIAHFYNAAQIVKPY FIHSLLFAIRDHDIVDQKELFREFGEKYLTMDGKLILSFVKSQSDLVASEVAVEMYSDFL EARDRANIAEDKYNNILKNGKQ
Uniprot No.

Target Background

Function
Structural component of the gap junctions.
Database Links

KEGG: cel:CELE_ZK792.2

STRING: 6239.ZK792.2.3

UniGene: Cel.12706

Protein Families
Pannexin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is Innexin-8 and what is its role in C. elegans?

Innexin-8 (INX-8) is a gap junction protein found in Caenorhabditis elegans that forms hemichannels in the hermaphrodite somatic gonad. These hemichannels couple with germline innexin hemichannels (composed of INX-14 with INX-21 or INX-22) to create functional gap junctions that promote germline proliferation and inhibit meiotic maturation . The protein consists of 382 amino acids and functions cooperatively with INX-9 to regulate essential developmental processes in the nematode gonad . Recent studies have revealed that INX-8/INX-9 channels facilitate the transport of key metabolites, including malonyl-CoA, across soma-germline junctions to ensure proper embryogenesis .

How do INX-8 and INX-9 function together in the somatic gonad?

INX-8 and INX-9 function redundantly in the somatic gonad to form hemichannels that are essential for germ cell proliferation and differentiation. Complete loss of both components results in a severely compromised germline with only a few germ cells that fail to undergo gametogenesis . Interestingly, restoration of inx-8 expression either to the distal tip cell (DTC) or to sheath cells is sufficient to rescue the severe germline proliferation defect observed in inx-8(0) inx-9(0) double mutants . This functional redundancy provides a robust mechanism ensuring proper germline development, though subtle differences in their expression patterns and interactions suggest distinct contributions to specific developmental processes.

What expression systems are most effective for recombinant INX-8 production?

For research purposes, E. coli has been successfully used to express recombinant full-length Innexin-8 protein . The recombinant protein typically includes a His-tag at the N-terminus to facilitate purification. While E. coli provides high yield and relative simplicity, eukaryotic expression systems might offer advantages for studies requiring proper post-translational modifications or membrane insertion. The expression protocol should be optimized based on specific research needs, with consideration for protein solubility, functionality, and structural integrity.

What are the recommended storage conditions for recombinant INX-8?

Recombinant INX-8 protein is typically supplied as a lyophilized powder and should be stored at -20°C/-80°C upon receipt . For practical laboratory use, the protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . To prevent degradation during storage, it's advisable to add glycerol to a final concentration of 5-50% (with 50% being a standard recommendation) and to aliquot the solution for long-term storage at -20°C/-80°C . Repeated freeze-thaw cycles should be avoided as they can significantly reduce protein activity and integrity. Working aliquots can be stored at 4°C for up to one week to minimize freeze-thaw damage .

How should researchers validate the quality of purified recombinant INX-8?

Quality assessment of recombinant INX-8 should include multiple validation steps:

  • Purity Analysis: SDS-PAGE analysis should confirm >90% purity

  • Identity Confirmation: Western blotting with anti-His antibodies or specific anti-INX-8 antibodies

  • Functional Assessment: Depending on experimental goals, this might include:

    • Hemichannel formation analysis via electron microscopy

    • Dye transfer assays if incorporated into liposomes or cell membranes

    • Binding assays with known interaction partners like INX-9 or germline innexins

Researchers should also verify protein concentration through standard methods such as Bradford or BCA assays, with adjustment for the His-tag contribution to total protein mass.

How can researchers study INX-8 gap junction formation and function?

To study INX-8 gap junction formation and function, researchers can employ several complementary approaches:

  • Genetic Analysis: Creating specific mutations in the inx-8 gene can reveal functional domains. For example, deletion mutants removing amino acids 1-349 have demonstrated the essential nature of these residues for membrane spanning and channel formation .

  • Fluorescent Protein Fusions: Tagging INX-8 with fluorescent proteins can visualize its localization and dynamics, though caution is warranted as some fusions (like mKate2::INX-8) can function as antimorphs that interfere with normal channel function .

  • Electrophysiology: Measuring electrical coupling between cells expressing INX-8-containing gap junctions.

  • Metabolite Transfer Studies: Tracing the movement of key molecules like malonyl-CoA across INX-8-containing junctions provides functional insight into channel permeability and selectivity .

  • Co-immunoprecipitation: To identify interaction partners and study hemichannel assembly.

What is the significance of antimorphic variants like mKate2::INX-8?

The mKate2::INX-8 fusion protein functions as a dominant antimorph that "poisons" innexin function . Studies have shown that this fusion protein significantly alters the positioning of the Sh1 somatic sheath cells at the distal end of the gonad . The antimorphic nature of this protein is evidenced by dosage studies, where removing the fusion protein through deletion mutations restores normal phenotypes .

How can researchers distinguish between channel and adhesion functions of INX-8?

Distinguishing between the channel and adhesion functions of INX-8 presents a significant challenge as these functions may be mechanistically coupled. Research suggests that:

  • Selective Mutations: Targeted mutations affecting specific domains might differentially impact channel versus adhesion functions.

  • Sequential Function Analysis: In mutants used for studying INX-8, gap junctions between soma and germline still form (evidenced by germ cell proliferation), but may do so less efficiently, with more diffuse localization patterns of gap junction puncta compared to wild-type .

  • Comparative Analysis: Studies of connexin gap-junction channels in paired Xenopus oocytes suggest that hemichannel opening facilitates their assembly into gap junctions by collapsing the intermembrane space, allowing extracellular loops to dock . If innexins follow a similar model, channel opening and adhesion functions would be intrinsically linked - the "rivet and channel" functions would be coupled .

  • Transgenic Approaches: Expression of INX-8 variants with mutations in channel-forming versus adhesion domains could help delineate these functions.

How does INX-8 contribute to germline stem cell regulation in C. elegans?

INX-8 plays a crucial role in regulating germline stem cells in C. elegans through several mechanisms:

  • Proliferation Promotion: Along with INX-9, it forms somatic hemichannels that couple with germline innexin hemichannels to promote germline proliferation . Loss of both INX-8 and INX-9 results in a germline with only a few germ cells that fail to develop properly .

  • Metabolite Transfer: These gap junctions facilitate the transfer of essential metabolites, including malonyl-CoA, from somatic cells to the germline, supporting proper embryogenesis .

  • Spatial Organization: The positioning of Sh1 somatic sheath cells relative to the distal tip cell influences the germline stem cell niche environment. When INX-8 function is compromised by antimorphic variants like mKate2::INX-8, Sh1 is mispositioned distally, potentially altering the signaling environment for germline stem cells .

  • Cell-Cell Interactions: The gap junctions formed by INX-8 may provide not only channels for molecular exchange but also adhesive functions that stabilize cell-cell contacts, creating a structural framework for the germline stem cell niche .

What research methods can resolve the spatial relationship between somatic gonad cells and germline stem cells?

To study the spatial relationship between somatic gonad cells and germline stem cells, researchers can employ:

  • Confocal Microscopy with Validated Markers: Using carefully validated fluorescent markers that don't perturb normal development. The cautionary tale of mKate2::INX-8, which artificially altered Sh1 positioning, highlights the importance of marker validation .

  • CRISPR-Cas9 Genome Editing: This technique has been valuable for generating specific mutations and deletions to study the effects of INX-8 variants on cell positioning. For example, creating deletions with identical breakpoints in different genetic backgrounds helped demonstrate the antimorphic nature of mKate2::INX-8 .

  • Phenotypic Classification: Developing standardized classification systems for gonad morphology. For instance, researchers have classified gonads into different categories based on Sh1 positioning relative to the distal end .

  • Brood Size and Embryonic Viability Analysis: This provides functional readouts of proper germline development and can reveal genetic interactions. For example, interaction studies between inx-8, inx-9, and inx-14 mutations demonstrated enhancement or suppression of reproductive defects .

What are the implications of INX-8 dysfunction for developmental biology?

The study of INX-8 dysfunction reveals several important principles in developmental biology:

  • Metabolite Exchange in Development: The finding that malonyl-CoA traverses INX-8-containing junctions demonstrates how metabolic coordination between different tissues supports embryogenesis .

  • Cellular Architecture and Fate Decisions: The mispositioning of Sh1 cells in INX-8 antimorphic mutants potentially alters the signaling environment for germline stem cells, demonstrating how spatial organization influences cell fate decisions .

  • Redundancy and Robustness: The functional redundancy between INX-8 and INX-9 illustrates how developmental systems build in robustness through overlapping gene functions .

  • Stress Sensitivity: Strains with antimorphic INX-8 variants displayed variable population growth dynamics attributed to stress, suggesting that compromised gap junction function may reduce developmental resilience to environmental challenges .

How can researchers address experimental artifacts when using tagged INX-8 variants?

When working with tagged INX-8 variants, researchers should implement these strategies to minimize experimental artifacts:

  • Functional Validation: Always validate that tagged proteins maintain wild-type function through rescue experiments and phenotypic analysis.

  • Multiple Tag Types/Positions: Test different tags and fusion positions (N-terminal vs. C-terminal) to identify the least disruptive configuration.

  • Dosage Controls: Include careful dosage studies to detect potential antimorphic effects, as was done with mKate2::INX-8 where heterozygotes were analyzed to reveal haploinsufficiency .

  • Complementary Approaches: Use alternative methods to confirm findings from tagged protein studies. For example, antibody staining of untagged proteins or RNA in situ hybridization can provide validation.

  • Generate Clean Deletions: As demonstrated with inx-8(qy78tn2031) and inx-8(tn2034), creating identical deletions in different genetic backgrounds can help isolate the effects of the tagged protein .

What controls are essential for INX-8 functional studies?

Essential controls for INX-8 functional studies include:

  • Wild-type Comparisons: Include wild-type specimens analyzed under identical conditions.

  • Genetic Background Controls: Ensure that any phenotypes are attributed to the inx-8 mutation rather than background mutations by using multiple independently generated alleles.

  • Transgenic Marker Controls: Verify that transgenic markers themselves don't affect the phenotype being studied. For example, brood size and embryonic viability analysis showed that certain marker transgenes had no appreciable effect on these parameters .

  • Dosage Series: Include heterozygotes and various allelic combinations to assess dosage sensitivity, which can reveal haploinsufficiency or antimorphic effects .

  • Single vs. Double Mutants: For proteins like INX-8 with redundant partners (INX-9), compare single and double mutant phenotypes to understand the contribution of each component.

How should researchers interpret contradictory findings in the INX-8 literature?

When confronting contradictory findings in the INX-8 literature, researchers should:

  • Evaluate Methodological Differences: For example, the discrepancy regarding the anatomical position of Sh1 cells was resolved by recognizing that the mKate2::INX-8 marker itself altered cell positioning .

  • Consider Genetic Background Effects: Different strain backgrounds may harbor modifiers that influence phenotypic outcomes.

  • Assess Environmental Conditions: Variable stress responses have been observed in strains with antimorphic INX-8 variants, suggesting that environmental factors might contribute to experimental variability .

  • Examine Protein Dynamics: Gap junction formation in the distal arm appears to involve looser associations of a few gap-junction channels compared to the large plaques formed at sheath-oocyte junctions . Such dynamic differences may lead to variable observations depending on experimental conditions.

  • Integrate Multiple Lines of Evidence: Combining genetic, cell biological, biochemical, and functional approaches provides the most robust interpretation of innexin function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.